Home » MLL5 » MLL5 Proteins » MLL5 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MLL5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MLL5 Protein (NBP2-33775PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

MLL5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MLL5.

Source: E. coli

Amino Acid Sequence: TYSQEGYDRSSTMLTLGPFRNSNLTELGLQEIKTIGYTSPRSRTEVNRQCPGEKEPVSDLQLGLDAVEPTALHKTLETPAHDRAEPNSQLDSTH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KMT2E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33775.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MLL5 Recombinant Protein Antigen

  • EC 2.1.1.43
  • FLJ10078
  • HDCMC04P
  • histone-lysine N-methyltransferase MLL5
  • KMT2EFLJ14026
  • Lysine N-methyltransferase 2E
  • MGC70452
  • myeloid/lymphoid or mixed-lineage leukemia 5 (trithorax homolog, Drosophila)
  • Myeloid/lymphoid or mixed-lineage leukemia protein 5

Background

MLL5 is a divergent member of the Drosophila Trithorax related SET and PHD domain containing chromatin regulators that are involved in the regulation of transcriptional "memory" during differentiation. Human MLL5 is located on chromosome 7q22, that is frequently deleted in myeloid leukemias. Inactivation of the Mll5 gene in mice results in a reduction in the average representation of hematopoietic stem cells, and in functional impairment of long term hematopoietic repopulation potential under competitive conditions. Overexpression of the protein also inhibits cell cycle progression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(43 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MLL3 Antibody
(6D1B9)
NBP3-27147
Flow Cytometry MLL3 Antibody (6D1B9)
Immunocytochemistry/ Immunofluorescence MLL3 Antibody (6D1B9)
Western Blot MLL3 Antibody (6D1B9)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NPM1 Antibody -
BSA Free
NB110-61646
Immunocytochemistry/ Immunofluorescence NPM1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence NPM1 Antibody - BSA Free
Western Blot NPM1 Antibody - BSA Free
(2 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
SETD1A Antibody
NB100-558
Immunoprecipitation SETD1A Antibody
Western Blot SETD1A Antibody
Immunohistochemistry-Paraffin SETD1A Antibody
(5 Publications)
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, WB
Histone H3
Antibody - BSA Free
NB500-171
Immunohistochemistry-Paraffin Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
(8 Reviews)
(34 Publications)
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
MID1 Antibody
NBP1-26612
Western Blot MID1 Antibody
(3 Publications)
Species: Hu
Applications: IP (-), WB
BAALC Antibody
NBP1-89443
Immunohistochemistry-Paraffin BAALC Antibody
Western Blot BAALC Antibody
Immunohistochemistry-Paraffin BAALC Antibody
Species: Hu
Applications: IHC, IHC-P, WB
NRAS Antibody
(6S6F3)
NBP3-16473
Immunocytochemistry/ Immunofluorescence NRAS Antibody (6S6F3)
Western Blot NRAS Antibody (6S6F3)
Western Blot NRAS Antibody (6S6F3)
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
MYF-5 Antibody
(OTI2G5)
NBP2-44245
Western Blot MYF-5 Antibody (OTI2G5)
Immunohistochemistry-Paraffin MYF-5 Antibody (OTI2G5)
Immunohistochemistry-Paraffin MYF-5 Antibody (OTI2G5)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
SETD7 Antibody
(OTI2D10)
NBP2-01066
Flow Cytometry SETD7 Antibody (OTI2D10)
Western Blot SETD7 Antibody (OTI2D10)
Immunohistochemistry-Paraffin SETD7 Antibody (OTI2D10)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CD117/c-kit
Antibody [Unconjugate
AF1356
Simple Western CD117/c-kit Antibody [Unconjugated]
Western Blot CD117/c-kit Antibody [Unconjugated]
Immunohistochemistry CD117/c-kit Antibody [Unconjugated]
(4 Reviews)
(116 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Myogenin Antibody
(671037)
MAB66861
Western Blot Myogenin Antibody (671037)
Immunocytochemistry Myogenin Antibody (671037)
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, WB
RAR alpha/NR1B1
Antibody (OTI2C3)
NBP2-45516
Immunohistochemistry RAR alpha/NR1B1 Antibody (OTI2C3)
Immunohistochemistry RAR alpha/NR1B1 Antibody (OTI2C3)
Western Blot RAR alpha/NR1B1 Antibody (OTI2C3)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Cyclin A2 Antibody
NBP1-31330
Western Blot Cyclin A2 Antibody
Western Blot Cyclin A2 Antibody
Immunocytochemistry/ Immunofluorescence Cyclin A2 Antibody
(3 Reviews)
(6 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for MLL5 Protein (NBP2-33775PEP) (0)

There are no publications for MLL5 Protein (NBP2-33775PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLL5 Protein (NBP2-33775PEP) (0)

There are no reviews for MLL5 Protein (NBP2-33775PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MLL5 Protein (NBP2-33775PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MLL5 Products

Array NBP2-33775PEP

Research Areas for MLL5 Protein (NBP2-33775PEP)

Find related products by research area.

Blogs on MLL5

There are no specific blogs for MLL5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of MO7e human megakaryocytic leukemic cell line, P815 mouse mastocytoma cell line and MC/9-2 mouse mast cell line, loaded at 0.2 mg/mL. A specific band was detected for CD117/c-kit at approximately 150-165 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.        
CD117/c-kit Antibody [Unconjugated]
AF1356
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MLL5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol KMT2E