Home » MIR16 » MIR16 Proteins » MIR16 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MIR16 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MIR16 Recombinant Protein Antigen (NBP3-17273PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MIR16 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MIR16

Source: E. coli

Amino Acid Sequence: CLLTGSLFVLLRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GDE1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17273.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MIR16 Recombinant Protein Antigen

  • EC 3.1.4.44
  • glycerophosphodiester phosphodiesterase 1
  • membrane interacting protein of RGS16
  • Membrane-interacting protein of RGS16
  • MIR16363E6.2
  • RGS16-interacting membrane protein

Background

MIR16, also referred to as Glycerophosphodiester phosphodiesterase 1 (GDE1), consists of a 331 amino acid isoform that is 38 kDa, and is involved in G-protein signaling pathways and glycerophosphoinositol phosphodiesterase activity. Current research is being conducted on the relationship between MIR16 and a variety of disorders and diseases, including multiple myeloma, mycobacterium tuberculosis, and gastric cancer. The protein interacts with RGS16, RGS1, RGS19, RGS2, and CLGN, and has been linked to the glycerol and lipid metabolic processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RGS16 Antibody
(OTI4E5)
NBP2-01584
Flow Cytometry RGS16 Antibody (OTI4E5)
Western Blot RGS16 Antibody (OTI4E5)
Immunohistochemistry-Paraffin RGS16 Antibody (OTI4E5)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Phospholipase B1
Antibody (C4)
NBP3-41952
Immunohistochemistry-Paraffin Phospholipase B1 Antibody (C4)
Species: Hu, Po
Applications: ICC/IF, IHC, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(815 Publications)
Species: Hu
Applications: BA
FAAH Antibody (4H8)
H00002166-M07
Western Blot FAAH Antibody (4H8)
ELISA FAAH Antibody (4H8)
Western Blot FAAH Antibody (4H8)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, WB
ABHD4 Antibody
NBP1-83711
Immunocytochemistry/ Immunofluorescence ABHD4 Antibody
Western Blot ABHD4 Antibody
Immunohistochemistry-Paraffin ABHD4 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RNF130 Antibody
NBP1-81858
Immunohistochemistry-Paraffin RNF130 Antibody
Western Blot RNF130 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
GNPDA1 Antibody
NBP2-24653
Western Blot GNPDA1 Antibody
Immunohistochemistry-Paraffin GNPDA1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Dicer Antibody -
BSA Free
NBP1-71691
Immunocytochemistry/ Immunofluorescence Dicer Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Dicer Antibody - BSA Free
Immunohistochemistry Dicer Antibody - BSA Free
(1 Review)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
EphA3 Antibody
[Unconjugated]
AF640
Immunohistochemistry EphA3 Antibody [Unconjugated]
(4 Publications)
Species: Mu
Applications: IHC, WB
TTP Antibody
(OTI8B5)
NBP2-02105
Flow Cytometry TTP Antibody (OTI8B5)
Western Blot TTP Antibody (OTI8B5)
Immunohistochemistry-Paraffin TTP Antibody (OTI8B5)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NAPE-PLD Antibody
NBP1-88248
Immunocytochemistry/ Immunofluorescence NAPE-PLD Antibody
Immunohistochemistry-Paraffin NAPE-PLD Antibody
Immunohistochemistry-Paraffin NAPE-PLD Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
(1 Publication)
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Tenascin C
Antibody (4C8MS) - BS
NB110-68136
Flow Cytometry Tenascin C Antibody (4C8MS) - BSA Free
Immunocytochemistry/ Immunofluorescence Tenascin C Antibody (4C8MS) - BSA Free
Flow Cytometry Tenascin C Antibody (4C8MS) - BSA Free
(2 Reviews)
(26 Publications)
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
ALDH7A1 Antibody
NBP2-15343
Immunocytochemistry/ Immunofluorescence ALDH7A1 Antibody
Western Blot ALDH7A1 Antibody
Immunohistochemistry-Paraffin ALDH7A1 Antibody
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
GDPD5 Antibody -
BSA Free
NBP2-41268
Immunohistochemistry GDPD5 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GDPD5 Antibody - BSA Free
Immunohistochemistry GDPD5 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
FA2H Antibody
(OTI2E3)
NBP2-45564
Western Blot FA2H Antibody (OTI2E3)
Immunofluorescence FA2H Antibody (OTI2E3)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
FBXW7/Cdc4 Antibody
NBP1-59631
Immunohistochemistry FBXW7/Cdc4 Antibody
Immunohistochemistry FBXW7/Cdc4 Antibody
Western Blot FBXW7/Cdc4 Antibody
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MIR16 Recombinant
Protein Antigen
NBP3-17273PEP
MIR16 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for MIR16 Recombinant Protein Antigen (NBP3-17273PEP) (0)

There are no publications for MIR16 Recombinant Protein Antigen (NBP3-17273PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIR16 Recombinant Protein Antigen (NBP3-17273PEP) (0)

There are no reviews for MIR16 Recombinant Protein Antigen (NBP3-17273PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MIR16 Recombinant Protein Antigen (NBP3-17273PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MIR16 Products

Blogs on MIR16

There are no specific blogs for MIR16, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Flow Cytometry: Tenascin C Antibody (4C8MS) [NB110-68136] - An intracellular stain was performed on SK-MEL-28 cells with Tenascin C Antibody (4C8MS) NB110-68136 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
Tenascin C Antibody (4C8MS) - BSA Free
NB110-68136

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MIR16 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GDE1