![Western Blot: LZTFL1 Antibody [NBP2-47387] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.](http://images.novusbio.com/fullsize/LZTFL1-Antibody-Western-Blot-NBP2-47387-img0003.jpg "Western Blot: LZTFL1 Antibody [NBP2-47387] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAPLNEGGTAELLN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LZTFL1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for LZTFL1 Antibody (NBP2-47387)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LZTFL1 |
![Immunocytochemistry/Immunofluorescence: LZTFL1 Antibody [NBP2-47387] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://images.novusbio.com/fullsize/LZTFL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47387-img0004.jpg "Immunocytochemistry/Immunofluorescence: LZTFL1 Antibody [NBP2-47387] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.")
![Immunohistochemistry-Paraffin: LZTFL1 Antibody [NBP2-47387] - Staining of human lymph node.](http://images.novusbio.com/fullsize/LZTFL1-Antibody-Immunohistochemistry-Paraffin-NBP2-47387-img0010.jpg "Immunohistochemistry-Paraffin: LZTFL1 Antibody [NBP2-47387] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: LZTFL1 Antibody [NBP2-47387] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/LZTFL1-Antibody-Immunohistochemistry-Paraffin-NBP2-47387-img0005.jpg "Immunohistochemistry-Paraffin: LZTFL1 Antibody [NBP2-47387] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: LZTFL1 Antibody [NBP2-47387] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/LZTFL1-Antibody-Immunohistochemistry-Paraffin-NBP2-47387-img0006.jpg "Immunohistochemistry-Paraffin: LZTFL1 Antibody [NBP2-47387] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: LZTFL1 Antibody [NBP2-47387] - Staining in human testis and skeletal muscle tissues using anti-LZTFL1 antibody. Corresponding LZTFL1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/LZTFL1-Antibody-Immunohistochemistry-Paraffin-NBP2-47387-img0007.jpg "Immunohistochemistry-Paraffin: LZTFL1 Antibody [NBP2-47387] - Staining in human testis and skeletal muscle tissues using anti-LZTFL1 antibody. Corresponding LZTFL1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: LZTFL1 Antibody [NBP2-47387] - Staining of human liver, lymph node, skeletal muscle and testis using Anti-LZTFL1 antibody NBP2-47387 (A) shows similar protein distribution across tissues to independent antibody NBP2-30690 (B).](http://images.novusbio.com/fullsize/LZTFL1-Antibody-Immunohistochemistry-Paraffin-NBP2-47387-img0008.jpg "Immunohistochemistry-Paraffin: LZTFL1 Antibody [NBP2-47387] - Staining of human liver, lymph node, skeletal muscle and testis using Anti-LZTFL1 antibody NBP2-47387 (A) shows similar protein distribution across tissues to independent antibody NBP2-30690 (B).")
![Immunohistochemistry-Paraffin: LZTFL1 Antibody [NBP2-47387] - Staining of human liver.](http://images.novusbio.com/fullsize/LZTFL1-Antibody-Immunohistochemistry-Paraffin-NBP2-47387-img0009.jpg "Immunohistochemistry-Paraffin: LZTFL1 Antibody [NBP2-47387] - Staining of human liver.")
![Immunocytochemistry CCR9 Antibody (112509) [Unconjugated]](https://images.novusbio.com/images2/CCR9_MAB179_Immunocytochemistry__Immunofluorescence_17206.jpg)
![Flow Cytometry CC Chemokine Receptor D6 Antibody (196124) [Unconjugated]](https://images.novusbio.com/images2/D6_MAB1364_Flow_Cytometry_15842.jpg)
![Immunocytochemistry LIMD1 Antibody (919330) [Unconjugated]](https://images.novusbio.com/images2/LIMD1_MAB8494_Immunocytochemistry_16234.jpg)
![Immunohistochemistry LIMD1 Antibody (919330) [Unconjugated]](https://images.novusbio.com/images2/LIMD1_MAB8494_Immunohistochemistry_16235.jpg)
![Western Blot LIMD1 Antibody (919330) [Unconjugated]](https://images.novusbio.com/images2/LIMD1_MAB8494_Western_Blot_16741.jpg)
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")