| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KDM4A. Source: E. coli Amino Acid Sequence: DVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELPPRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDLSSEQYEMTEC Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | KDM4A |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87855. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW | 31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Protein (NBP1-87855PEP)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KDM4A |
![Western Blot G9a/EHMT2 Antibody (A8620A) [Unconjugated]](https://images.novusbio.com/images/pp-a8620a-00_human-mouse-g9a-ehmt2-mab-clone-a8620a-4120241252118.jpg)
![Immunohistochemistry G9a/EHMT2 Antibody (A8620A) [Unconjugated]](https://images.novusbio.com/images/pp-a8620a-00_human-mouse-g9a-ehmt2-mab-clone-a8620a-412024125214.jpg)
![Immunohistochemistry G9a/EHMT2 Antibody (A8620A) [Unconjugated]](https://images.novusbio.com/images/pp-a8620a-00_human-mouse-g9a-ehmt2-mab-clone-a8620a-4120241251265.jpg)
![N/A alpha-Defensin 1 [Biotin]](https://images.novusbio.com/images2/DATA_alphaDefensin_1_DY819805_ELISA_2534.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot ASCL2/Mash2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ASCL2_AF6539_Western_Blot_10231.jpg)
![Immunohistochemistry ASCL2/Mash2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af6539_human-ascl2-mash2-affinity-purified-polyclonal-ab-immunohistochemistry-1262023144847.jpg)
![Immunoprecipitation: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody [NB110-40585] - Detection of human Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A by western blot of immunoprecipitates. Samples: Nuclear Extract (1 mg for IP; 20% of IP loaded) from HEK293T cells. Antibodies: Affinity purified rabbit anti-Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A antibody NB110-40585 used for IP at 6 ug per reaction. Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A was also immunoprecipitated by rabbit anti-Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A antibody NB110-40584. For blotting immunoprecipitated Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A, NB110-40585 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](https://images.novusbio.com/images/Lysine-K-specific-Demethylase-4A-KDM4A-JMJD2A-Antibody-Immunoprecipitation-NB110-40585-img0005.jpg "Immunoprecipitation: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody [NB110-40585] - Detection of human Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A by western blot of immunoprecipitates. Samples: Nuclear Extract (1 mg for IP; 20% of IP loaded) from HEK293T cells. Antibodies: Affinity purified rabbit anti-Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A antibody NB110-40585 used for IP at 6 ug per reaction. Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A was also immunoprecipitated by rabbit anti-Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A antibody NB110-40584. For blotting immunoprecipitated Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A, NB110-40585 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.")