![Western Blot: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody [NBP1-87855] - Analysis in human cell line HEK 293.](http://images.novusbio.com/fullsize/Lysine-K-specific-Demethylase-4A-KDM4A-JMJD2A-Antibody-Western-Blot-NBP1-87855-img0009.jpg "Western Blot: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody [NBP1-87855] - Analysis in human cell line HEK 293.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELPPRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDLSSEQYEMTEC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KDM4A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 25336657). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (NBP1-87855)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KDM4A |
![Immunocytochemistry/Immunofluorescence: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody [NBP1-87855] - Staining of human cell line U-2 OS shows positivity in nucleoli.](http://images.novusbio.com/fullsize/Lysine-K-specific-Demethylase-4A-KDM4A-JMJD2A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87855-img0007.jpg "Immunocytochemistry/Immunofluorescence: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody [NBP1-87855] - Staining of human cell line U-2 OS shows positivity in nucleoli.")
![Immunohistochemistry-Paraffin: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody [NBP1-87855] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Lysine-K-specific-Demethylase-4A-KDM4A-JMJD2A-Antibody-Immunohistochemistry-Paraffin-NBP1-87855-img0014.jpg "Immunohistochemistry-Paraffin: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody [NBP1-87855] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody [NBP1-87855] - Staining of human cerebellum shows strong positivity in nucleoli in Purkinje cells.](http://images.novusbio.com/fullsize/Lysine-K-specific-Demethylase-4A-KDM4A-JMJD2A-Antibody-Immunohistochemistry-Paraffin-NBP1-87855-img0010.jpg "Immunohistochemistry-Paraffin: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody [NBP1-87855] - Staining of human cerebellum shows strong positivity in nucleoli in Purkinje cells.")
![Immunohistochemistry-Paraffin: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody [NBP1-87855] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Lysine-K-specific-Demethylase-4A-KDM4A-JMJD2A-Antibody-Immunohistochemistry-Paraffin-NBP1-87855-img0011.jpg "Immunohistochemistry-Paraffin: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody [NBP1-87855] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody [NBP1-87855] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Lysine-K-specific-Demethylase-4A-KDM4A-JMJD2A-Antibody-Immunohistochemistry-Paraffin-NBP1-87855-img0013.jpg "Immunohistochemistry-Paraffin: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody [NBP1-87855] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot G9a/EHMT2 Antibody (A8620A) [Unconjugated]](https://images.novusbio.com/images/pp-a8620a-00_human-mouse-g9a-ehmt2-mab-clone-a8620a-4120241252118.jpg)
![Immunohistochemistry G9a/EHMT2 Antibody (A8620A) [Unconjugated]](https://images.novusbio.com/images/pp-a8620a-00_human-mouse-g9a-ehmt2-mab-clone-a8620a-412024125214.jpg)
![Immunohistochemistry G9a/EHMT2 Antibody (A8620A) [Unconjugated]](https://images.novusbio.com/images/pp-a8620a-00_human-mouse-g9a-ehmt2-mab-clone-a8620a-4120241251265.jpg)
![N/A alpha-Defensin 1 [Biotin]](https://images.novusbio.com/images2/DATA_alphaDefensin_1_DY819805_ELISA_2534.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot ASCL2/Mash2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ASCL2_AF6539_Western_Blot_10231.jpg)
![Immunohistochemistry ASCL2/Mash2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af6539_human-ascl2-mash2-affinity-purified-polyclonal-ab-immunohistochemistry-1262023144847.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")