![Immunohistochemistry-Paraffin: LRP2 Antibody [NBP1-85292] - Staining in human kidney and skeletal muscle tissues.. Corresponding LRP2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/LRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-85292-img0013.jpg "Immunohistochemistry-Paraffin: LRP2 Antibody [NBP1-85292] - Staining in human kidney and skeletal muscle tissues.. Corresponding LRP2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GFTSMSDRPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYLQDEEYIQAVDYDWDPEDIGLSVVYYTVRGEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLKYVMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LRP2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Publication using NBP1-85292 | Applications | Species |
|---|---|---|
| Ma LJ, Corsa BA, Zhou J et al. Angiotensin type 1 receptor modulates macrophage polarization and renal injury in obesity. Am J Physiol Renal Physiol 2011-05-01 [PMID: 21367915] |
Secondary Antibodies |
Isotype Controls |
Research Areas for LRP2 Antibody (NBP1-85292)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: LRP2 Antibody [NBP1-85292] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/LRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-85292-img0010.jpg "Immunohistochemistry-Paraffin: LRP2 Antibody [NBP1-85292] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: LRP2 Antibody [NBP1-85292] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/LRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-85292-img0011.jpg "Immunohistochemistry-Paraffin: LRP2 Antibody [NBP1-85292] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: LRP2 Antibody [NBP1-85292] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/LRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-85292-img0012.jpg "Immunohistochemistry-Paraffin: LRP2 Antibody [NBP1-85292] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: LRP2 Antibody [NBP1-85292] - Staining of human thyroid gland shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/LRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-85292-img0014.jpg "Immunohistochemistry-Paraffin: LRP2 Antibody [NBP1-85292] - Staining of human thyroid gland shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Immunohistochemistry_24138.jpg)
![Western Blot Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Western_Blot_20441.jpg)
![Simple Western Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Simple_Western_20573.jpg)
![Immunohistochemistry LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDL_R_AF2255_Immunohistochemistry_7149.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDLR_AF2255_Western_Blot_23731.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images/af2255_mouse-ldl-r-affinity-purified-polyclonal-ab-4120241049445.jpg)
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9945.jpg)
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9946.jpg)
![Western Blot Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images/af2747_mouse-clusterin-affinity-purified-polyclonal-ab-4120241240247.jpg)
![Immunohistochemistry VLDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/VLDL_R_AF2258_Immunohistochemistry_22497.jpg)
![Immunohistochemistry VLDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/VLDL_R_AF2258_Immunohistochemistry_9765.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")