![Western Blot: LPP Antibody [NBP1-89555] - Analysis using Anti-LPP antibody NBP1-89555 (A) shows similar pattern to independent antibody NBP1-89549 (B).](http://images.novusbio.com/fullsize/LPP-Antibody-Western-Blot-NBP1-89555-img0011.jpg "Western Blot: LPP Antibody [NBP1-89555] - Analysis using Anti-LPP antibody NBP1-89555 (A) shows similar pattern to independent antibody NBP1-89549 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSPHYMAAPSSGQIYGSGPQGYNTQPVPVSGQCPPPSTRGGMDYAYIPPPGLQPEPGYGYAPNQGRYYEGYYAAGPGYGGRNDSDPTYGQQGHPNTWKREPGY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LPP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot HIC5/TGFB1I1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HIC5_AF5626_Western_Blot_5782.jpg)
![Immunocytochemistry HIC5/TGFB1I1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HIC5_AF5626_Immunocytochemistry__Immunofluorescence_19725.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for LPP Antibody (NBP1-89555)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LPP |
![Immunocytochemistry/Immunofluorescence: LPP Antibody [NBP1-89555] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & focal adhesion sites.](http://images.novusbio.com/fullsize/LPP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89555-img0007.jpg "Immunocytochemistry/Immunofluorescence: LPP Antibody [NBP1-89555] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & focal adhesion sites.")
![Immunohistochemistry-Paraffin: LPP Antibody [NBP1-89555] - Staining in human smooth muscle and pancreas tissues using anti-LPP antibody. Corresponding LPP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/LPP-Antibody-Immunohistochemistry-Paraffin-NBP1-89555-img0010.jpg "Immunohistochemistry-Paraffin: LPP Antibody [NBP1-89555] - Staining in human smooth muscle and pancreas tissues using anti-LPP antibody. Corresponding LPP RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: LPP Antibody [NBP1-89555] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.](http://images.novusbio.com/fullsize/LPP-Antibody-Immunohistochemistry-Paraffin-NBP1-89555-img0002.jpg "Immunohistochemistry-Paraffin: LPP Antibody [NBP1-89555] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.")
![Immunohistochemistry-Paraffin: LPP Antibody [NBP1-89555] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/LPP-Antibody-Immunohistochemistry-Paraffin-NBP1-89555-img0008.jpg "Immunohistochemistry-Paraffin: LPP Antibody [NBP1-89555] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: LPP Antibody [NBP1-89555] - Staining of human smooth muscle shows high expression.](http://images.novusbio.com/fullsize/LPP-Antibody-Immunohistochemistry-Paraffin-NBP1-89555-img0009.jpg "Immunohistochemistry-Paraffin: LPP Antibody [NBP1-89555] - Staining of human smooth muscle shows high expression.")
![Simple Western HMGA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HMGA2_AF3184_Simple_Western_16679.jpg)
![Western Blot HMGA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HMGA2_AF3184_Western_Blot_7403.jpg)
![Immunocytochemistry HMGA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3184_human-mouse-hmga2-affinity-purified-polyclonal-ab-immunocytochemistry-4122020143513.jpg)
![Immunohistochemistry Complement Factor H Antibody [Unconjugated]](https://images.novusbio.com/images2/Complement_Factor_H_AF4779_Immunohistochemistry_7182.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")