Home » Lebercilin » Lebercilin Proteins » Lebercilin Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Lebercilin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Lebercilin Recombinant Protein Antigen (NBP2-48587PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Lebercilin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lebercilin.

Source: E. coli

Amino Acid Sequence: NSGNVRSPASPNEFAFGSYVPSFAKTSERSNPFSQKSSFLDFQRNSMEKLSKDGVDLITRKEKKANLMEQLFGASG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LCA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48587.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lebercilin Recombinant Protein Antigen

  • C6orf152Leber congenital amaurosis 5 protein
  • chromosome 6 open reading frame 152
  • Leber congenital amaurosis 5
  • Lebercilin

Background

The LCA5 gene encodes a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this genecause Leber congenital amaurosis type V. Alternatively spliced transcript variants are described. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RPE65 Antibody
(401.8B11.3D9) - BSA ...
NB100-355
Immunocytochemistry/ Immunofluorescence RPE65 Antibody (401.8B11.3D9) - BSA Free
Immunohistochemistry-Frozen RPE65 Antibody (401.8B11.3D9) - BSA Free
Western Blot RPE65 Antibody (401.8B11.3D9) - BSA Free
(7 Reviews)
(98 Publications)
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
RPGRIP1 Antibody
NBP2-55753
Immunohistochemistry-Paraffin RPGRIP1 Antibody
Immunohistochemistry-Paraffin RPGRIP1 Antibody
Immunohistochemistry-Paraffin RPGRIP1 Antibody
Species: Hu
Applications: IHC, IHC-P
GUCY2D Antibody
NBP3-12211
Immunohistochemistry-Paraffin GUCY2D Antibody
Unknown GUCY2D Antibody
Western Blot GUCY2D Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
RDH12 Antibody
(1E11)
H00145226-M01
Sandwich ELISA RDH12 Antibody (1E11)
Immunocytochemistry/ Immunofluorescence RDH12 Antibody (1E11)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AIPL1 Antibody
(OTI3B4)
NBP2-01327
Flow Cytometry AIPL1 Antibody (OTI3B4)
Western Blot AIPL1 Antibody (OTI3B4)
Immunohistochemistry-Paraffin AIPL1 Antibody (OTI3B4)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CRB1 Antibody
NBP2-56113
Immunohistochemistry-Paraffin CRB1 Antibody
Immunohistochemistry-Paraffin CRB1 Antibody
Immunohistochemistry-Paraffin CRB1 Antibody
Species: Hu
Applications: IHC, IHC-P
CEP290 Antibody
NB100-86991
Western Blot CEP290 Antibody
Western Blot CEP290 Antibody
Immunocytochemistry/ Immunofluorescence CEP290 Antibody
(12 Publications)
Species: Hu, Mu
Applications: ICC/IF, IP, WB
TULP1 Antibody
NBP1-31401
Immunocytochemistry/ Immunofluorescence TULP1 Antibody
Immunohistochemistry-Paraffin TULP1 Antibody
Western Blot TULP1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CRX/CORD2 Antibody
(4G11)
H00001406-M02
Western Blot CRX/CORD2 Antibody (4G11)
Immunocytochemistry/ Immunofluorescence CRX/CORD2 Antibody (4G11)
ELISA CRX/CORD2 Antibody (4G11)
(32 Publications)
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
SPATA7 Antibody
NBP1-83195
Immunocytochemistry/ Immunofluorescence SPATA7 Antibody
Immunohistochemistry-Paraffin SPATA7 Antibody
Immunohistochemistry-Paraffin SPATA7 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CD45 Antibody
[Unconjugated]
AF114
Immunohistochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]
(1 Review)
(70 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
OFD1 Antibody
NBP1-89355
Immunohistochemistry-Paraffin OFD1 Antibody
Immunohistochemistry-Paraffin OFD1 Antibody
Immunohistochemistry-Paraffin OFD1 Antibody
(9 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Clathrin light
chain + heavy chain A ...
NBP1-05035
Western Blot Clathrin light chain + heavy chain Antibody
Immunohistochemistry-Paraffin Clathrin light chain + heavy chain Antibody
(3 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NMNAT-1 Antibody
H00064802-B01P
Immunocytochemistry/ Immunofluorescence NMNAT-1 Antibody
Immunocytochemistry/ Immunofluorescence NMNAT-1 Antibody
Western Blot NMNAT-1 Antibody
(1 Review)
(2 Publications)
Species: Ha, Hu
Applications: ICC/IF, WB
ERG Antibody - BSA
Free
NBP2-60655
Immunocytochemistry/ Immunofluorescence ERG Antibody - BSA Free
Western Blot ERG Antibody - BSA Free
Immunohistochemistry-Paraffin ERG Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Kv11.1 Antibody -
Azide and BSA Free
NBP3-03109
Immunohistochemistry-Paraffin Kv11.1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Kv11.1 Antibody - Azide and BSA Free
Western Blot Kv11.1 Antibody - Azide and BSA Free
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NINL Antibody
NBP1-81451
Immunohistochemistry-Paraffin NINL Antibody
Immunohistochemistry-Paraffin NINL Antibody
Immunohistochemistry-Paraffin NINL Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
LRAT Antibody
(M34-P1F10) - BSA Fre
NBP2-50444
Immunocytochemistry/ Immunofluorescence LRAT Antibody (M34-P1F10) - BSA Free
Western Blot LRAT Antibody (M34-P1F10) - BSA Free
Immunohistochemistry LRAT Antibody (M34-P1F10) - BSA Free
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, WB
Mer Antibody
[Unconjugated]
AF591
Flow Cytometry Mer Antibody [Unconjugated]
Immunohistochemistry Mer Antibody [Unconjugated]
Dual RNAscope ISH-IHC Compatible Mer Antibody [Unconjugated]
(2 Reviews)
(71 Publications)
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC
Lebercilin
Recombinant Protein A
NBP2-48587PEP
Lebercilin Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Lebercilin Recombinant Protein Antigen (NBP2-48587PEP) (0)

There are no publications for Lebercilin Recombinant Protein Antigen (NBP2-48587PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lebercilin Recombinant Protein Antigen (NBP2-48587PEP) (0)

There are no reviews for Lebercilin Recombinant Protein Antigen (NBP2-48587PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lebercilin Recombinant Protein Antigen (NBP2-48587PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lebercilin Products

Blogs on Lebercilin

There are no specific blogs for Lebercilin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: RPE65 Antibody (401.8B11.3D9) - BSA Free [NB100-355] - ICC-IF analysis of cultured ARPE19 cells, a spontaneously arising human retinal pigment epithelia cell line - 10 minutes fixation in 4% PFA, 10 minutes permeabilization in PBS containing 0.2% Triton X-100 (PBS-T), 1 hour blocking in 10% normal goat serum containing 1% BSA in PBS-T, 1:100 primary antibody dilution in PBS, ON 4C incubation.
RPE65 Antibody (401.8B11.3D9) - BSA Free
NB100-355
J774A.1 mouse reticulum cell sarcoma macrophage cell line was stained with Goat Anti-Mouse Mer Antigen Affinity-purified Polyclonal Antibody (Catalog # AF591, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Mer Antibody [Unconjugated]
AF591
CD45 was detected in immersion fixed paraffin-embedded sections of mouse liver using Goat Anti-Mouse CD45 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF114) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to Kupffer cells. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
CD45 Antibody [Unconjugated]
AF114

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lebercilin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LCA5