IBSP/Sialoprotein II Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse IBSP/Sialoprotein II (NP_032344.2). Peptide sequence MACAFSMKNFHRRIKAEDSEENGVFKYRPRYFLYKHAYFYPPLKRFPVQG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
IBSP |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
35 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for IBSP/Sialoprotein II Antibody
Background
The protein encoded by the Sialoprotein II gene is a major structural protein of the bone matrix. It constitutes approximately 12% ofthe noncollagenous proteins in human bone and is synthesized by skeletal-associated cell types, including hypertrophicchondrocytes, osteoblasts, osteocytes, and osteoclasts. The only extraskeletal site of its synthesis is thetrophoblast. This protein binds to calcium and hydroxyapatite via its acidic amino acid clusters, and mediates cellattachment through an RGD sequence that recognizes the vitronectin receptor. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: ICC
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: WB
Publications for IBSP/Sialoprotein II Antibody (NBP3-10985) (0)
There are no publications for IBSP/Sialoprotein II Antibody (NBP3-10985).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IBSP/Sialoprotein II Antibody (NBP3-10985) (0)
There are no reviews for IBSP/Sialoprotein II Antibody (NBP3-10985).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IBSP/Sialoprotein II Antibody (NBP3-10985) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IBSP/Sialoprotein II Products
Research Areas for IBSP/Sialoprotein II Antibody (NBP3-10985)
Find related products by research area.
|
Blogs on IBSP/Sialoprotein II