Novus Biologicals products are now on bio-techne.com

HspA1L Recombinant Protein Antigen

Name: HspA1L Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-92012PEP
Price: 279 USD

Images

There are currently no images for HspA1L Protein (NBP1-92012PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HspA1L Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSPA1L. Source: E. coli Amino Acid Sequence: KLYQGGCTGPACGTGYVPGRPATGPTIEEVD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	HSPA1L
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92012. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HspA1L Recombinant Protein Antigen

heat shock 10kDa protein 1-like
Heat shock 70 kDa protein 1-Hom
Heat shock 70 kDa protein 1L
heat shock 70 kDa protein 1-like
heat shock 70kD protein-like 1
heat shock 70kDa protein 1-like
HSP70-1L
HSP70-HOM
HSP70T
hum70t

Background

HSPA1L encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HspA1B Antibody
(3B7)

H00003304-M02

Immunocytochemistry/ Immunofluorescence HspA1B Antibody (3B7)

(6 Publications)

Species: Bv, Hu, Mu, Po, Rt

Applications: DB, ELISA, ICC/IF, IHC, IHC-P, PLA, WB

HSP70/HSPA1A
[Biotin]

DYC1663-2

(25 Publications)

Species: Hu, Mu, Rt

Applications: ELISA

HspA4 Antibody

NBP1-81696

Immunohistochemistry-Paraffin HspA4 Antibody

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

HSPA2 Antibody

NBP1-86185

Immunohistochemistry-Paraffin HSPA2 Antibody

(5 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, KD, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(813 Publications)

Species: Hu

Applications: BA

GRP78/HSPA5
Antibody - BSA Free

NBP1-06274

Immunocytochemistry/ Immunofluorescence GRP78/HSPA5 Antibody - BSA Free

(2 Reviews)

(43 Publications)

Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze

Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB

MHC Class I
Antibody (OX18) - BSA

NB120-6405

Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free

(33 Publications)

Species: Rt

Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

HspA6 Antibody

NBP1-85949

Immunohistochemistry-Paraffin HspA6 Antibody

(1 Review)

(1 Publication)

Species: Hu, Po

Applications: IHC, IHC-P, WB

Lymphotoxin-alpha/TNF- ...

211-TBB/CF

Bioactivity Lymphotoxin-alpha/TNF-beta [Unconjugated]

(8 Publications)

Species: Hu

Applications: BA

Recombinant Human
HLA DRB4 GST (N-Term) ...

H00003126-P01

(1 Publication)

Species: Hu

Applications: ELISA, AP, PA, WB

HLA B Antibody
(2G7B10) - BSA Free

NBP2-61871

Flow Cytometry HLA B Antibody (2G7B10) - BSA Free

Immunocytochemistry/ Immunofluorescence HLA B Antibody (2G7B10) - BSA Free

Species: Hu

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

HO-1/HMOX1/HSP32
Antibody (HO-1-1)

NBP1-97507

Immunohistochemistry-Paraffin HO-1/HMOX1/HSP32 Antibody (HO-1-1)

Western Blot HO-1/HMOX1/HSP32 Antibody (HO-1-1)

(1 Review)

(20 Publications)

Species: Bv, Ca, Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB

PARP Antibody
(194C1439) - Cleaved ...

NBP2-27335

Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free

(1 Review)

(9 Publications)

Species: Hu, Mu, Rt(-)

Applications: CyTOF-ready, Flow, ICC/IF, WB

HDJ2 Antibody

NBP1-88019

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, KD, WB

Integrin beta
3/CD61 Antibody (SJ19

NBP2-67416

Immunohistochemistry-Paraffin Integrin beta 3/CD61 Antibody (SJ19-09)

(2 Reviews)

(6 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

HLA DRB1 Antibody
(SPM288)

NBP2-45312

Flow Cytometry HLA DRB1 Antibody (SPM288)

Immunofluorescence HLA DRB1 Antibody (SPM288)

(2 Publications)

Species: Hu, Pm, Mu(-)

Applications: Flow, ICC/IF, IHC, IHC-P, WB

HLA DRB3 Antibody
(Bra30)

NBP3-07168

Species: Pm, Ca, Pm, Hu, Pm, Sq

Applications: Flow, ICC/IF

ICAM-1/CD54
Antibody [Unconjugate

AF796

Western Blot ICAM-1/CD54 Antibody [Unconjugated]

(6 Reviews)

(88 Publications)

Species: Mu

Applications: AdBlk, IHC, WB

HSPA8/HSC71/Hsc70
Antibody (13D3)

NB120-2788

(2 Reviews)

(28 Publications)

Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt

Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

HspA1L Recombinant
Protein Antigen

NBP1-92012PEP

Species: Hu

Applications: AC

Publications for HspA1L Protein (NBP1-92012PEP) (0)

There are no publications for HspA1L Protein (NBP1-92012PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HspA1L Protein (NBP1-92012PEP) (0)

There are no reviews for HspA1L Protein (NBP1-92012PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HspA1L Protein (NBP1-92012PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HspA1L Products

Research Areas for HspA1L Protein (NBP1-92012PEP)

Find related products by research area.

Cancer

Blogs on HspA1L

There are no specific blogs for HspA1L, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

ICAM-1/CD54 was detected in perfusion fixed frozen sections of mouse testis using Goat Anti-Mouse ICAM-1/CD54 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF796) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane in Leydig cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.

ICAM-1/CD54 Antibody [Unconjugated]
AF796

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our HspA1L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

HSPA1L

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

HspA1L Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

HspA1L Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for HspA1L Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for HspA1L Protein (NBP1-92012PEP) (0)

Reviews for HspA1L Protein (NBP1-92012PEP) (0)

FAQs for HspA1L Protein (NBP1-92012PEP) (0)

Additional HspA1L Products

Research Areas for HspA1L Protein (NBP1-92012PEP)

Blogs on HspA1L

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics