![Western Blot: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337] - Human Spleen lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize/Hepcidin-Antimicrobial-Peptide-Antibody-Western-Blot-NBP1-59337-img0002.jpg "Western Blot: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337] - Human Spleen lysate, concentration 0.2-1 ug/ml.")
| Reactivity | Hu, Mu, BvSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | Synthetic peptides corresponding to HAMP(hepcidin antimicrobial peptide) The peptide sequence was selected from the N terminal of HAMP. Peptide sequence MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HAMP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Immunohistochemistry Paraffin (IHC-P) reported in verified customer review. |
|
| Theoretical MW | 9 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC-P | Mouse | 04/10/2019 |
Summary
Comments
|
||||||||||
Enlarge |
reviewed by:
Verified Customer |
WB | Mouse | 08/08/2018 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Verified Customer |
IHC-P | Bovine | 08/03/2018 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Verified Customer |
IHC-P | Human | 07/13/2018 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 07/11/2018 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Verified Customer |
WB | Bovine | 06/29/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 04/10/2019 |
||
| Application: | IHC-P | |
| Species: | Mouse |
| Verified Customer 08/08/2018 |
||
| Application: | WB | |
| Species: | Mouse |
| Verified Customer 08/03/2018 |
||
| Application: | IHC-P | |
| Species: | Bovine |
![Immunohistochemistry-Paraffin: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337] - Paraffin embedded sections of posterior segment of mouse eye, red is Hepcidin and blue is Hoeschst. 4um sections were rehydrated with xylene, followed by a decreasing ethanol concentration gradient (100%, 90%, 70%) and a wash with diH2O. Heat-mediated antigen retrieval performed using EDTA buffer (10mM Trizma Base, 1mM EDTA solution, 0.05% Tween 20, pH 9.0) in an autoclave for 30min. Primary antibody against Hepcidin was diluted 1:10, in blocking solution containing 0.1% BSA, 0.05% Triton X-100, and 5% normal donkey serum in TBS. Sections were incubated for 48hrs at room temperature and then 24hrs at 4C. Tissues were washed with TBS-T (6x5min), and immunoreactivity for Hep was developed. Image from verified customer review.](http://images.novusbio.com/fullsize/Hepcidin-Antimicrobial-Peptide-Antibody-Immunohistochemistry-Paraffin-NBP1-59337-img0003.jpg "Immunohistochemistry-Paraffin: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337] - Paraffin embedded sections of posterior segment of mouse eye, red is Hepcidin and blue is Hoeschst. 4um sections were rehydrated with xylene, followed by a decreasing ethanol concentration gradient (100%, 90%, 70%) and a wash with diH2O. Heat-mediated antigen retrieval performed using EDTA buffer (10mM Trizma Base, 1mM EDTA solution, 0.05% Tween 20, pH 9.0) in an autoclave for 30min. Primary antibody against Hepcidin was diluted 1:10, in blocking solution containing 0.1% BSA, 0.05% Triton X-100, and 5% normal donkey serum in TBS. Sections were incubated for 48hrs at room temperature and then 24hrs at 4C. Tissues were washed with TBS-T (6x5min), and immunoreactivity for Hep was developed. Image from verified customer review.")
![Immunocytochemistry RGM-C/Hemojuvelin Antibody [Unconjugated]](https://images.novusbio.com/images2/RGM-C_AF3720_Immunocytochemistry_12460.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Holo-Transferrin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Holo-Transferrin [Unconjugated]")
![Simple Western TfR2 Antibody (353816) [Unconjugated]](https://images.novusbio.com/images2/TfR2_MAB3120_Simple_Western_17630.jpg)
![Western Blot TfR2 Antibody (353816) [Unconjugated]](https://images.novusbio.com/images2/TfR2_MAB3120_Western_Blot_17658.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![SDS-PAGE BMP-6 [Unconjugated]](https://images.novusbio.com/images2/BMP-6_507-BP_374.jpg)
![Bioactivity BMP-6 [Unconjugated]](https://images.novusbio.com/images2/BMP-6_507-BP_376.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot CHMP2B Antibody (791521) [Unconjugated]](https://images.novusbio.com/images2/CHMP2B_MAB7509_Western_Blot_12719.jpg)
![Immunohistochemistry CHMP2B Antibody (791521) [Unconjugated]](https://images.novusbio.com/images2/CHMP2B_MAB7509_Immunohistochemistry_13107.jpg)
![Knockout Validated CHMP2B Antibody (791521) [Unconjugated]](https://images.novusbio.com/images2/mab7509_human-chmp2b-mab-clone-791521-knockout-validated-89202211244.jpg)
![N/A GDF-15 [HRP]](https://images.novusbio.com/images2/GDF15_DGD150_ELISA_108.jpg)
![N/A GDF-15 [HRP]](https://images.novusbio.com/images2/GDF15_DGD150_ELISA_698.jpg)
![N/A GDF-15 [HRP]](https://images.novusbio.com/images2/GDF15_DGD150_ELISA_2661.jpg)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/DATA_TIMP1_DTM100_ELISA_847.jpg)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/TIMP-1_DTM100_ELISA_194.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
