GRK4 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: ESGCFKDINKSESEEALPLDLDKNIHTPVSRPNRGFFYRLFRRGGCLTMVPSEKEVEPKQ |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GRK4 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for GRK4 Antibody
Background
A guanine nucleotide-binding protein (G Protein)-coupled receptor kinase subfamily, of the Ser/Thr protein kinase family, is encoded by the gene GRK4. There are a total of four isoforms of this gene: GRK4-alpha is 578 amino acids long at 66 kDA; GRK4-beta is 546 amino acids long at 63 kDA; GRK4-delta is 500 amino acids long at 57 kDA; and isoform 4, GRK4-gamma is 532 amino acids long at 61 kDA. GRK4-alpha is inhibited by caulmodulin and can phosphorylate rhodopsin, however the three other forms of GRK4 do not interact with calmodulin. GRK4 has been investigated in hypertension, breast cancer, aortic coarctation, and atherosclerosis. It participates in endocytosis and the chemokine signaling pathway through interactions with the CALM1, CALM2, CALM3, FSHR, and IKBKG genes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: KO, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: IHC
Publications for GRK4 Antibody (NBP2-37960) (0)
There are no publications for GRK4 Antibody (NBP2-37960).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GRK4 Antibody (NBP2-37960) (0)
There are no reviews for GRK4 Antibody (NBP2-37960).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for GRK4 Antibody (NBP2-37960) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GRK4 Products
Research Areas for GRK4 Antibody (NBP2-37960)
Find related products by research area.
|
Blogs on GRK4