![Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54961] - The results of western blotting and RT-PCR assayA. shows Western blotting results, where the PDHA1 protein expression in the parental LNCaP cells is strongly positive, but its expression in the PDHA1 KO cells is almost negative with two different PDHA1 antibodies. Comparatively, the protein expression of the MPC1 and MPC2 is comparatively decreased and the protein expression of the GLUT1, HK2, LDHA, HIF1alpha, GLS1 and GLUD1 (Glutamate Dehydrogenase) is increased in the LNCaP PDHA1 KO cells. GAPDH was added as a loading control. Image collected and cropped by CiteAb from the following publication (www.oncotarget.com/lookup/doi/10.18632/oncotarget.10782) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Glutamate-Dehydrogenase-Antibody-Western-Blot-NBP1-54961-img0007.jpg "Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54961] - The results of western blotting and RT-PCR assayA. shows Western blotting results, where the PDHA1 protein expression in the parental LNCaP cells is strongly positive, but its expression in the PDHA1 KO cells is almost negative with two different PDHA1 antibodies. Comparatively, the protein expression of the MPC1 and MPC2 is comparatively decreased and the protein expression of the GLUT1, HK2, LDHA, HIF1alpha, GLS1 and GLUD1 (Glutamate Dehydrogenase) is increased in the LNCaP PDHA1 KO cells. GAPDH was added as a loading control. Image collected and cropped by CiteAb from the following publication (www.oncotarget.com/lookup/doi/10.18632/oncotarget.10782) licensed under a CC-BY license.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to GLUD1(glutamate dehydrogenase 1) The peptide sequence was selected from the N terminal of GLUD1. Peptide sequence EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF. The peptide sequence for this immunogen was taken from within the described region. |
| Marker | Mitochondria Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GLUD1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 56 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Simple Western GLUD1/GLUD2 Antibody (848209) [Unconjugated]](https://images.novusbio.com/images2/Glutamate_Dehydrogenase_2_MAB8027_Simple_Western_17156.jpg)
![Western Blot GLUD1/GLUD2 Antibody (848209) [Unconjugated]](https://images.novusbio.com/images2/Glutamate_Dehydrogenase_2_MAB8027_Western_Blot_13127.jpg)
![Immunohistochemistry GLUD1/GLUD2 Antibody (848209) [Unconjugated]](https://images.novusbio.com/images2/GLUD1_GLUD2_MAB8027_Immunohistochemistry_20442.jpg)
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
| Publication using NBP1-54961 | Applications | Species |
|---|---|---|
| Li Y, Li X, et al. PDHA1 gene knockout in prostate cancer cells results in metabolic reprogramming towards greater glutamine dependence. Oncotarget 2016-08-16 [PMID: 27462778] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Glutamate Dehydrogenase Antibody (NBP1-54961)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: Glutamate Dehydrogenase Antibody [NBP1-54961] - GLS1 and GLUD1 (Glutamate Dehydrogenase) are over-expressed in prostate cancers and associated with poor survival. Immunohistochemical staining of GLUD1 in human prostate cancers with Gleason score 4 (D), 7 (E). and 9 (F). Image collected and cropped by CiteAb from the following publication (www.oncotarget.com/lookup/doi/10.18632/oncotarget.10782) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Glutamate-Dehydrogenase-Antibody-Immunohistochemistry-NBP1-54961-img0006.jpg "Immunohistochemistry: Glutamate Dehydrogenase Antibody [NBP1-54961] - GLS1 and GLUD1 (Glutamate Dehydrogenase) are over-expressed in prostate cancers and associated with poor survival. Immunohistochemical staining of GLUD1 in human prostate cancers with Gleason score 4 (D), 7 (E). and 9 (F). Image collected and cropped by CiteAb from the following publication (www.oncotarget.com/lookup/doi/10.18632/oncotarget.10782) licensed under a CC-BY license.")
![Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54961] - HT1080 cell lysate, concentration 1ug/ml.](http://images.novusbio.com/fullsize/Glutamate-Dehydrogenase-Antibody-Western-Blot-NBP1-54961-img0001.jpg "Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54961] - HT1080 cell lysate, concentration 1ug/ml.")
![Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54961] - lanes 5: rat kidney cordex lanes 6: rat kidney proximal tubules prepped from cortex lanes 7: LLCPK-F+ pig kidney proximal tubule tissue culture lysate lanes 8: rat brain supernatant](http://images.novusbio.com/fullsize/Glutamate-Dehydrogenase-Antibody-Western-Blot-NBP1-54961-img0002.jpg "Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54961] - lanes 5: rat kidney cordex lanes 6: rat kidney proximal tubules prepped from cortex lanes 7: LLCPK-F+ pig kidney proximal tubule tissue culture lysate lanes 8: rat brain supernatant")
![Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54961] - Human colon tissue.](http://images.novusbio.com/fullsize/Glutamate-Dehydrogenase-Antibody-Immunohistochemistry-Paraffin-NBP1-54961-img0003.jpg "Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54961] - Human colon tissue.")
![Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54961] - Human kidney, renal tubular epithelium in cortex.](http://images.novusbio.com/fullsize/Glutamate-Dehydrogenase-Antibody-Immunohistochemistry-Paraffin-NBP1-54961-img0004.jpg "Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54961] - Human kidney, renal tubular epithelium in cortex.")
![Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54961] - Human pancreas tissue](http://images.novusbio.com/fullsize/Glutamate-Dehydrogenase-Antibody-Immunohistochemistry-Paraffin-NBP1-54961-img0005.jpg "Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54961] - Human pancreas tissue")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")