Home » Fructosamine-3-kinase-related » Fructosamine-3-kinase-related Proteins » Fructosamine-3-kinase-related Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Fructosamine-3-kinase-related Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Fructosamine-3-kinase-related Recombinant Protein Antigen (NBP2-55370PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Fructosamine-3-kinase-related Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FN3KRP.

Source: E. coli

Amino Acid Sequence: GSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFVARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FN3KRP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55370.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Fructosamine-3-kinase-related Recombinant Protein Antigen

  • EC 2.7.1.-
  • EC 2.7.1.172
  • FLJ12171
  • FN3KL
  • FN3K-related protein
  • FN3KRP
  • FN3K-RP
  • fructosamine 3 kinase related protein
  • Fructosamine-3-kinase-related protein
  • ketosamine-3-kinase
  • Protein-psicosamine 3-kinase FN3KRP

Background

FN3KRP and FN3K (MIM 608425) protect proteins from nonenzymatic glycation by phosphorylating the modified amino acid. This phosphorylation destabilizes the sugar-amine linkage and leads to spontaneous decomposition (Conner et al., 2004 [PubMed 15381090]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FN3K Antibody
(HL2223) - Azide and ...
NBP3-25469
Immunohistochemistry-Paraffin FN3K Antibody (HL2223) - Azide and BSA Free
Immunohistochemistry-Paraffin FN3K Antibody (HL2223) - Azide and BSA Free
Western Blot FN3K Antibody (HL2223) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Sphingosine Kinase
1/SPHK1 Antibody (1D6 ...
H00008877-M01
ELISA Sphingosine Kinase 1/SPHK1 Antibody (1D6)
Western Blot Sphingosine Kinase 1/SPHK1 Antibody (1D6)
Western Blot Sphingosine Kinase 1/SPHK1 Antibody (1D6)
(13 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Lysozyme Antibody
- BSA Free
NBP2-61118
Simple Western Lysozyme Antibody - BSA Free
Flow Cytometry Lysozyme Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Lysozyme Antibody - BSA Free
(7 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
EphA3 Antibody
[Unconjugated]
AF640
Immunohistochemistry EphA3 Antibody [Unconjugated]
(4 Publications)
Species: Mu
Applications: IHC, WB
S1P1/EDG-1
Antibody (713412) [Un ...
MAB7089
Flow Cytometry S1P1/EDG-1 Antibody (713412) [Unconjugated]
Flow Cytometry S1P1/EDG-1 Antibody (713412) [Unconjugated]
Immunohistochemistry S1P1/EDG-1 Antibody (713412) [Unconjugated]
(28 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC
SP1 Antibody
NB600-232
Western Blot SP1 Antibody
Immunohistochemistry-Paraffin SP1 Antibody
Western Blot SP1 Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(31 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
PSG1 [HRP]
DPSG10
N/A PSG1 [HRP]
N/A PSG1 [HRP]
(2 Publications)
Species: Hu
Applications: ELISA
COCO/DAND5
[Unconjugated]
3047-CC
COCO/DAND5 [Unconjugated]
(4 Publications)
Species: Hu
Applications: BA
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Immunoprecipitation Glucose 6 Phosphate Dehydrogenase Antibody
Western Blot Glucose 6 Phosphate Dehydrogenase Antibody
Western Blot Glucose 6 Phosphate Dehydrogenase Antibody
(19 Publications)
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
MARCKS like
protein Antibody
NBP2-38160
Immunohistochemistry-Paraffin MARCKS like protein Antibody
Immunohistochemistry-Paraffin MARCKS like protein Antibody
Immunohistochemistry-Paraffin MARCKS like protein Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GPR177/WLS Antibody
NBP2-57299
Western Blot GPR177/WLS Antibody
Immunohistochemistry-Paraffin GPR177/WLS Antibody
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
PTP alpha/PTPRA
Antibody
NBP3-14454
Immunohistochemistry-Paraffin PTP alpha/PTPRA Antibody
Immunohistochemistry-Paraffin PTP alpha/PTPRA Antibody
Immunohistochemistry-Paraffin PTP alpha/PTPRA Antibody
Species: Hu
Applications: IHC, IHC-P
Recombinant Human
MBTPS1 GST (N-Term) P ...
H00008720-Q01
Other Recombinant Human MBTPS1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
MRP1 Antibody
(IU2H10) - BSA Free
NB400-156
Dual RNAscope ISH-IHC MRP1 Antibody (IU2H10) - BSA Free
Western Blot MRP1 Antibody (IU2H10) - BSA Free
Immunocytochemistry/ Immunofluorescence MRP1 Antibody (IU2H10) - BSA Free
(17 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB

Fructosamine-3-kinase- ...
NBP2-55370PEP
Fructosamine-3-kinase-related Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Fructosamine-3-kinase-related Recombinant Protein Antigen (NBP2-55370PEP) (0)

There are no publications for Fructosamine-3-kinase-related Recombinant Protein Antigen (NBP2-55370PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fructosamine-3-kinase-related Recombinant Protein Antigen (NBP2-55370PEP) (0)

There are no reviews for Fructosamine-3-kinase-related Recombinant Protein Antigen (NBP2-55370PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Fructosamine-3-kinase-related Recombinant Protein Antigen (NBP2-55370PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fructosamine-3-kinase-related Products

Research Areas for Fructosamine-3-kinase-related Recombinant Protein Antigen (NBP2-55370PEP)

Find related products by research area.

Blogs on Fructosamine-3-kinase-related

There are no specific blogs for Fructosamine-3-kinase-related, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Fructosamine-3-kinase-related Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FN3KRP