| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Fibulin 1. Source: E. coli Amino Acid Sequence: CESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | FBLN1 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52918. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW | 33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for Fibulin 1 Recombinant Protein Antigen (NBP2-52918PEP)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FBLN1 |
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/Versican_AF3054_Immunocytochemistry_6488.jpg)
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/af3054_human-versican-affinity-purified-polyclonal-ab-immunocytochemistry-842022131824.jpg)
![Immunocytochemistry/ Immunofluorescence Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images/af3054_human-versican-affinity-purified-polyclonal-ab-22820241723618.jpg)
![Western Blot Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Western_Blot_17244.jpg)
![Simple Western Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Simple_Western_17469.jpg)
![Immunohistochemistry Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Immunohistochemistry_17623.jpg)
![Western Blot Fibulin 5/DANCE Antibody (293904) [Unconjugated]](https://images.novusbio.com/images2/Fibulin_5_MAB3095_Western_Blot_10968.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Western_Blot_20730.jpg)
![Immunohistochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunohistochemistry_10419.jpg)
![Immunocytochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunocytochemistry__Immunofluorescence_23321.jpg)
![Immunohistochemistry Nidogen-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Nidogen2_AF3385_Immunohistochemistry_21102.jpg)
![N/A Thrombospondin-1 [HRP]](https://images.novusbio.com/images2/Thrombospondin-1_DTSP10_ELISA_199.jpg)
![Immunohistochemistry-Paraffin: Fibulin 1 Antibody [NBP1-84725] - Analysis in human placenta and skeletal muscle tissues using NBP1-84725 antibody. Corresponding FBLN1 RNA-seq data are presented for the same tissues.](https://images.novusbio.com/images/Fibulin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-84725-img0012.jpg "Immunohistochemistry-Paraffin: Fibulin 1 Antibody [NBP1-84725] - Analysis in human placenta and skeletal muscle tissues using NBP1-84725 antibody. Corresponding FBLN1 RNA-seq data are presented for the same tissues.")