![Immunohistochemistry-Paraffin: Fibulin 1 Antibody (CL0337) [NBP2-52918] - Staining in human cervix, uterine and liver tissues. Corresponding FBLN1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Fibulin-1-Antibody-CL0337-Immunohistochemistry-Paraffin-NBP2-52918-img0019.jpg "Immunohistochemistry-Paraffin: Fibulin 1 Antibody (CL0337) [NBP2-52918] - Staining in human cervix, uterine and liver tissues. Corresponding FBLN1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clone | CL0337 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNE |
| Predicted Species | Mouse (92%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | FBLN1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
| Publication using NBP2-52918 | Applications | Species |
|---|---|---|
| Peng L, Jin X, He Q et al. Remodelling landscape of tissue-engineered bladder with porcine small intestine submucosa using single-cell RNA sequencing Cell proliferation 2022-09-30 [PMID: 36177893] (IF/IHC, Mouse) | IF/IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for Fibulin 1 Antibody (NBP2-52918)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FBLN1 |
![Western Blot: Fibulin 1 Antibody (CL0337) [NBP2-52918] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-FBLN1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/Fibulin-1-Antibody-CL0337-Western-Blot-NBP2-52918-img0013.jpg "Western Blot: Fibulin 1 Antibody (CL0337) [NBP2-52918] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-FBLN1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Western Blot: Fibulin 1 Antibody (CL0337) [NBP2-52918] - Lane 1: Marker [kDa] Lane 2: Human plasma](http://images.novusbio.com/fullsize/Fibulin-1-Antibody-CL0337-Western-Blot-NBP2-52918-img0012.jpg "Western Blot: Fibulin 1 Antibody (CL0337) [NBP2-52918] - Lane 1: Marker [kDa] Lane 2: Human plasma")
![Immunohistochemistry-Paraffin: Fibulin 1 Antibody (CL0337) [NBP2-52918] - Staining of human uterine cervix shows strong positivity in the extracellular matrix.](http://images.novusbio.com/fullsize/Fibulin-1-Antibody-CL0337-Immunohistochemistry-Paraffin-NBP2-52918-img0015.jpg "Immunohistochemistry-Paraffin: Fibulin 1 Antibody (CL0337) [NBP2-52918] - Staining of human uterine cervix shows strong positivity in the extracellular matrix.")
![Immunohistochemistry-Paraffin: Fibulin 1 Antibody (CL0337) [NBP2-52918] - Staining of human prostate shows moderate positivity in the extracellular matrix.](http://images.novusbio.com/fullsize/Fibulin-1-Antibody-CL0337-Immunohistochemistry-Paraffin-NBP2-52918-img0016.jpg "Immunohistochemistry-Paraffin: Fibulin 1 Antibody (CL0337) [NBP2-52918] - Staining of human prostate shows moderate positivity in the extracellular matrix.")
![Immunohistochemistry-Paraffin: Fibulin 1 Antibody (CL0337) [NBP2-52918] - Staining of human breast cancer shows moderate positivity in the extracellular matrix of tumor stroma.](http://images.novusbio.com/fullsize/Fibulin-1-Antibody-CL0337-Immunohistochemistry-Paraffin-NBP2-52918-img0017.jpg "Immunohistochemistry-Paraffin: Fibulin 1 Antibody (CL0337) [NBP2-52918] - Staining of human breast cancer shows moderate positivity in the extracellular matrix of tumor stroma.")
![Immunohistochemistry-Paraffin: Fibulin 1 Antibody (CL0337) [NBP2-52918] - Staining of human liver shows no positivity as expected.](http://images.novusbio.com/fullsize/Fibulin-1-Antibody-CL0337-Immunohistochemistry-Paraffin-NBP2-52918-img0018.jpg "Immunohistochemistry-Paraffin: Fibulin 1 Antibody (CL0337) [NBP2-52918] - Staining of human liver shows no positivity as expected.")
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/Versican_AF3054_Immunocytochemistry_6488.jpg)
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/af3054_human-versican-affinity-purified-polyclonal-ab-immunocytochemistry-842022131824.jpg)
![Immunocytochemistry/ Immunofluorescence Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images/af3054_human-versican-affinity-purified-polyclonal-ab-22820241723618.jpg)
![Western Blot Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Western_Blot_17244.jpg)
![Simple Western Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Simple_Western_17469.jpg)
![Immunohistochemistry Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Immunohistochemistry_17623.jpg)
![Western Blot Fibulin 5/DANCE Antibody (293904) [Unconjugated]](https://images.novusbio.com/images2/Fibulin_5_MAB3095_Western_Blot_10968.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Western_Blot_20730.jpg)
![Immunohistochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunohistochemistry_10419.jpg)
![Immunocytochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunocytochemistry__Immunofluorescence_23321.jpg)
![Immunohistochemistry Nidogen-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Nidogen2_AF3385_Immunohistochemistry_21102.jpg)
![N/A Thrombospondin-1 [HRP]](https://images.novusbio.com/images2/Thrombospondin-1_DTSP10_ELISA_199.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")