![Western Blot: EWSR1 Antibody [NBP2-49380] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue](http://images.novusbio.com/fullsize/EWSR1-Antibody-Western-Blot-NBP2-49380-img0002.jpg "Western Blot: EWSR1 Antibody [NBP2-49380] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPG |
| Predicted Species | Mouse (98%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EWSR1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for EWSR1 Antibody (NBP2-49380)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EWSR1 |
![Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human skin.](http://images.novusbio.com/fullsize/EWSR1-Antibody-Immunohistochemistry-Paraffin-NBP2-49380-img0008.jpg "Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human skin.")
![Immunohistochemistry: EWSR1 Antibody [NBP2-49380] - Staining of human colon shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/EWSR1-Antibody-Immunohistochemistry-NBP2-49380-img0001.jpg "Immunohistochemistry: EWSR1 Antibody [NBP2-49380] - Staining of human colon shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/EWSR1-Antibody-Immunohistochemistry-Paraffin-NBP2-49380-img0003.jpg "Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/EWSR1-Antibody-Immunohistochemistry-Paraffin-NBP2-49380-img0004.jpg "Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining in human testis and skeletal muscle tissues using anti-EWSR1 antibody. Corresponding EWSR1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/EWSR1-Antibody-Immunohistochemistry-Paraffin-NBP2-49380-img0005.jpg "Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining in human testis and skeletal muscle tissues using anti-EWSR1 antibody. Corresponding EWSR1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human colon, liver, skin and testis using Anti-EWSR1 antibody NBP2-49380 (A) shows similar protein distribution across tissues to independent antibody NBP2-49020 (B).](http://images.novusbio.com/fullsize/EWSR1-Antibody-Immunohistochemistry-Paraffin-NBP2-49380-img0006.jpg "Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human colon, liver, skin and testis using Anti-EWSR1 antibody NBP2-49380 (A) shows similar protein distribution across tissues to independent antibody NBP2-49020 (B).")
![Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human liver.](http://images.novusbio.com/fullsize/EWSR1-Antibody-Immunohistochemistry-Paraffin-NBP2-49380-img0007.jpg "Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human liver.")
![Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human colon.](http://images.novusbio.com/fullsize/EWSR1-Antibody-Immunohistochemistry-Paraffin-NBP2-49380-img0009.jpg "Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human colon.")
![Flow Cytometry CD99 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD99_AF3968_Flow_Cytometry_8220.jpg)
![Western Blot CD99 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD99_AF3968_Western_Blot_23993.jpg)
![Simple Western CD99 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD99_AF3968_Simple_Western_24089.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Bioactivity GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212GD_2846.jpg)
![SDS-PAGE GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212-GD_62.jpg)
![SEC-MALS GDNF [Unconjugated]](https://images.novusbio.com/images/212-gd_recombinant-human-gdnf-protein-sec-mals-25202393740..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")