Reactivity | HuSpecies Glossary |
Applications | WB |
Clone | 5P4K1 |
Clonality | Monoclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Additional Information | Recombinant Monoclonal Antibody |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ets-1 (P14921). MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCM |
Isotype | IgG |
Clonality | Monoclonal |
Host | Rabbit |
Gene | ETS1 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Ets-1 Antibody (NBP3-15807)Find related products by research area.
|
HIF-3 alpha: a versatile target with hypoxia dependent and independent functions By: Subhash GangarHIF-3 alpha (hypoxia-inducible factor 3-alpha/ HIF3A) represents an isoform of HIF-alpha subunits which heterodimerize with stable beta subunit (HIF-beta) for the regulation of HIF target genes through binding to hypoxia respon... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ETS1 |