Home » eIF4E » eIF4E Proteins » eIF4E Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

eIF4E Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for eIF4E Recombinant Protein Antigen (NBP3-21317PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

eIF4E Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human eIF4E

Source: E.coli

Amino Acid Sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EIF4E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21317. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for eIF4E Recombinant Protein Antigen

  • CBP
  • eIF4E
  • eIF-4E
  • EIF4E1
  • EIF4EL1
  • EIF4EL1MGC111573
  • eIF-4F 25 kDa subunit
  • EIF4F
  • eukaryotic translation initiation factor 4E
  • eukaryotic translation initiation factor 4E-like 1
  • mRNA cap-binding protein

Background

eIF-4E is a eukaryotic translation initiation factor involved in directing ribosomes to the cap structure of mRNAs. It exists in two forms: as a free form (25 kDa) and as part of a multiprotein complex eIF-4F (1). eIF-4E appears to be the least abundant of the initiation factors and acts as a rate-limiting step of initiation (2). Since translation is regulated by phosphorylation, eIF-4E phosphorylation at Ser 209 by MAPK signal-integrating kinase 1 (Mnk1) and kinase 2 (Mnk2) may directly regulate the rate of protein synthesis initiation (3). There is also evidence that eIF-4E can function as an oncogene (4-5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

KAT3B/p300
Antibody (RW105) - BS
NB100-616
Immunocytochemistry/ Immunofluorescence KAT3B/p300 Antibody (RW105) - BSA Free
Flow Cytometry KAT3B/p300 Antibody (RW105) - BSA Free
Immunocytochemistry/ Immunofluorescence KAT3B/p300 Antibody (RW105) - BSA Free
(13 Publications)
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
CBP/KAT3A Antibody
(257003) [Unconjugate ...
MAB2676
Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]
Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
4EBP1 Antibody
NB200-157
Knockout Validated 4EBP1 Antibody
Western Blot 4EBP1 Antibody
Western Blot 4EBP1 Antibody
(45 Publications)
Species: Hu
Applications: IHC, IHC-P, KO, WB
eIF4G1 Antibody
NB100-268
Western Blot eIF4G1 Antibody
Immunoprecipitation eIF4G1 Antibody
(26 Publications)
Species: Hu, Po
Applications: IP, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
CREB [p Ser133]
[Biotin]
DYC2510-2
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
Ribosomal Protein
S6/RPS6 [p Ser235, p ...
AF3918
Western Blot Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]
Simple Western Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]
Immunohistochemistry Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
PCAF Antibody
(5E11)
H00008850-M04
Immunocytochemistry/ Immunofluorescence PCAF Antibody (5E11)
Sandwich ELISA PCAF Antibody (5E11)
Western Blot PCAF Antibody (5E11)
(1 Review)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Tbp7 Antibody
NBP1-87799
Immunohistochemistry-Paraffin Tbp7 Antibody
Western Blot Tbp7 Antibody
Western Blot Tbp7 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SRC1 Antibody
(1135)
NB200-310
Western Blot SRC1 Antibody (1135)
(1 Review)
(4 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
eIF4A1 Antibody
NBP2-24632
Western Blot eIF4A1 Antibody
Immunohistochemistry-Paraffin eIF4A1 Antibody
Western Blot eIF4A1 Antibody
(2 Publications)
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(807 Publications)
Species: Hu
Applications: BA
NCOA3/AIB1 Antibody
NB100-314
Western Blot NCOA3/AIB1 Antibody
Western Blot NCOA3/AIB1 Antibody
(1 Review)
(4 Publications)
Species: Hu
Applications: IP, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow

Publications for eIF4E Recombinant Protein Antigen (NBP3-21317PEP) (0)

There are no publications for eIF4E Recombinant Protein Antigen (NBP3-21317PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF4E Recombinant Protein Antigen (NBP3-21317PEP) (0)

There are no reviews for eIF4E Recombinant Protein Antigen (NBP3-21317PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for eIF4E Recombinant Protein Antigen (NBP3-21317PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional eIF4E Products

Research Areas for eIF4E Recombinant Protein Antigen (NBP3-21317PEP)

Find related products by research area.

Blogs on eIF4E

There are no specific blogs for eIF4E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our eIF4E Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol EIF4E