Novus Biologicals products are now on bio-techne.com

eIF4E Recombinant Protein Antigen

Images

 
There are currently no images for eIF4E Recombinant Protein Antigen (NBP2-57098PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

eIF4E Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human eIF4E.

Source: E. coli

Amino Acid Sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EIF4E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57098.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for eIF4E Recombinant Protein Antigen

  • CBP
  • eIF4E
  • eIF-4E
  • EIF4E1
  • EIF4EL1
  • EIF4EL1MGC111573
  • eIF-4F 25 kDa subunit
  • EIF4F
  • eukaryotic translation initiation factor 4E
  • eukaryotic translation initiation factor 4E-like 1
  • mRNA cap-binding protein

Background

eIF-4E is a eukaryotic translation initiation factor involved in directing ribosomes to the cap structure of mRNAs. It exists in two forms: as a free form (25 kDa) and as part of a multiprotein complex eIF-4F (1). eIF-4E appears to be the least abundant of the initiation factors and acts as a rate-limiting step of initiation (2). Since translation is regulated by phosphorylation, eIF-4E phosphorylation at Ser 209 by MAPK signal-integrating kinase 1 (Mnk1) and kinase 2 (Mnk2) may directly regulate the rate of protein synthesis initiation (3). There is also evidence that eIF-4E can function as an oncogene (4-5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NB200-157
Species: Hu
Applications: IHC, IHC-P, KO, WB
NB100-268
Species: Hu, Po
Applications: IP, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
AF3918
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
H00008850-M04
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-310
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-24632
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-314
Species: Hu
Applications: IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow

Publications for eIF4E Recombinant Protein Antigen (NBP2-57098PEP) (0)

There are no publications for eIF4E Recombinant Protein Antigen (NBP2-57098PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF4E Recombinant Protein Antigen (NBP2-57098PEP) (0)

There are no reviews for eIF4E Recombinant Protein Antigen (NBP2-57098PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for eIF4E Recombinant Protein Antigen (NBP2-57098PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional eIF4E Products

Research Areas for eIF4E Recombinant Protein Antigen (NBP2-57098PEP)

Find related products by research area.

Blogs on eIF4E

There are no specific blogs for eIF4E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our eIF4E Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4E