![Immunohistochemistry: DRIL1 Antibody [NBP3-38452] - Immunohistochemistry analysis of paraffin-embedded Rat lung using DRIL1 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-38452_rabbit-dril1-pab-1012202411404094.jpg "Immunohistochemistry: DRIL1 Antibody [NBP3-38452] - Immunohistochemistry analysis of paraffin-embedded Rat lung using DRIL1 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 324-593 of human DRIL1 (NP_005215.1). Sequence: PYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQNFLAMAAQLPMSIRINSQASESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPAPTPTSAPNKGGGGGGGSSSNAGGRGGNTGTSGGQAGPAGLSTPSTSTSNNSLP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARID3A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 63 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ARID3A |
![Immunoprecipitation: DRIL1 Antibody [NBP3-38452] - Immunoprecipitation analysis of 150 ug extracts of MCF7 cells using 3 ug DRIL1 antibody. Western blot was performed from the immunoprecipitate using DRIL1 antibody at a dilution of 1:500.](http://images.novusbio.com/fullsize/nbp3-38452_rabbit-dril1-pab-1012202411433438.jpg "Immunoprecipitation: DRIL1 Antibody [NBP3-38452] - Immunoprecipitation analysis of 150 ug extracts of MCF7 cells using 3 ug DRIL1 antibody. Western blot was performed from the immunoprecipitate using DRIL1 antibody at a dilution of 1:500.")
![Western Blot: DRIL1 Antibody [NBP3-38452] - Western blot analysis of lysates from K-562 cells using DRIL1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.](http://images.novusbio.com/fullsize/nbp3-38452_rabbit-dril1-pab-1012202411392950.jpg "Western Blot: DRIL1 Antibody [NBP3-38452] - Western blot analysis of lysates from K-562 cells using DRIL1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.")
![Immunohistochemistry: DRIL1 Antibody [NBP3-38452] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using DRIL1 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-38452_rabbit-dril1-pab-1012202411334051.jpg "Immunohistochemistry: DRIL1 Antibody [NBP3-38452] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using DRIL1 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry BTK [p Tyr223] Antibody - BSA Free](https://images.novusbio.com/images/BTK-[p-Tyr223]-Antibody-Immunohistochemistry-NBP1-78295-img0002.jpg)
![Western Blot BTK [p Tyr223] Antibody - BSA Free](https://images.novusbio.com/images/BTK-[p-Tyr223]-Antibody-Western-Blot-NBP1-78295-img0004.jpg)
![Neutralization TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Block_Neutralize_875.jpg)
![Western Blot TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Western_Blot_5303.jpg)
![Immunohistochemistry TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Immunohistochemistry_17355.jpg)
![Western Blot IRF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/IRF1_AF4715_Western_Blot_5529.jpg)
![Western Blot IRF1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af4715_mouse-irf1-affinity-purified-polyclonal-ab-western-blot-16122024101037..png)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")