Home » DGK-alpha » DGK-alpha Peptides and Proteins » Recombinant Human DGK-alpha GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human DGK-alpha GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human DGK-alpha Protein [H00001606-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human DGK-alpha Protein [H00001606-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human DGK-alpha GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-735 of Human DGKA

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
DGKA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
109 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DGK-alpha GST (N-Term) Protein

  • DAG kinase alpha
  • DAGK
  • DAGK1
  • DAGK1diacylglycerol kinase, alpha (80kD)
  • DGKA
  • DGKalpha
  • DGK-alpha
  • DGK-alphaEC 2.7.1.107
  • diacylglycerol kinase alpha
  • diacylglycerol kinase, alpha 80kDa
  • Diglyceride kinase alpha
  • MGC12821,80 kDa diacylglycerol kinase
  • MGC42356

Background

The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DGK-beta Antibody
(646523)
MAB6727
Western Blot DGK-beta Antibody (646523)
Species: Hu
Applications: WB
Deoxyguanosine
kinase Antibody
NBP1-84256
Western Blot Deoxyguanosine kinase Antibody
Immunohistochemistry-Paraffin Deoxyguanosine kinase Antibody
Immunohistochemistry-Paraffin Deoxyguanosine kinase Antibody
Species: Hu
Applications: IHC, IHC-P, WB
DGK-epsilon
Antibody (670914)
MAB5125
Western Blot DGK-epsilon Antibody (670914)
Immunohistochemistry DGK-epsilon Antibody (670914)
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, WB
Dystroglycan
Antibody [Unconjugate
AF6868
Immunohistochemistry Dystroglycan Antibody [Unconjugated]
Western Blot Dystroglycan Antibody [Unconjugated]
Knockout Validated Dystroglycan Antibody [Unconjugated]
(23 Publications)
Species: Hu
Applications: IHC, KO, WB
Pallidin Antibody
(OTI1H9)
NBP2-01763
Western Blot Pallidin Antibody (OTI1H9)
Flow Cytometry Pallidin Antibody (OTI1H9)
Immunohistochemistry-Paraffin Pallidin Antibody (OTI1H9)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Recombinant Human
PRH1 His Protein
NBP2-23368
SDS-PAGE Recombinant Human PRH1 His Protein
Species: Hu
Applications: PAGE
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
EPB42 Antibody
(2G12)
H00002038-M01
Western Blot EPB42 Antibody (2G12)
ELISA EPB42 Antibody (2G12)
Immunocytochemistry/ Immunofluorescence EPB42 Antibody (2G12)
Species: Hu
Applications: ELISA, ICC/IF, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
Rasgrp1 Antibody -
BSA Free
NBP2-94157
Immunocytochemistry/ Immunofluorescence Rasgrp1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Rasgrp1 Antibody - BSA Free
Western Blot Rasgrp1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(813 Publications)
Species: Hu
Applications: BA
hnRNP C1 + C2
Antibody (CL2593)
NBP2-36776
Western Blot hnRNP C1 + C2 Antibody (CL2593)
Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)
Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
PFDN4 Antibody -
Azide and BSA Free
NBP2-93935
Immunocytochemistry/ Immunofluorescence PFDN4 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence PFDN4 Antibody - Azide and BSA Free
Western Blot PFDN4 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(453 Publications)
Species: Hu
Applications: BA

Publications for DGK-alpha Recombinant Protein (H00001606-P02) (0)

There are no publications for DGK-alpha Recombinant Protein (H00001606-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DGK-alpha Recombinant Protein (H00001606-P02) (0)

There are no reviews for DGK-alpha Recombinant Protein (H00001606-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DGK-alpha Recombinant Protein (H00001606-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DGK-alpha Products

Research Areas for DGK-alpha Recombinant Protein (H00001606-P02)

Find related products by research area.

Blogs on DGK-alpha

There are no specific blogs for DGK-alpha, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
IFN-gamma [Unconjugated]
285-IF-100

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DGK-alpha GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol DGKA