![Immunocytochemistry/Immunofluorescence: Desmoglein-1 Antibody [NBP3-17012] - Analysis in human skin and stomach tissues using Anti-DSG1 antibody. Corresponding DSG1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Desmoglein-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-17012-img0001.jpg "Immunocytochemistry/Immunofluorescence: Desmoglein-1 Antibody [NBP3-17012] - Analysis in human skin and stomach tissues using Anti-DSG1 antibody. Corresponding DSG1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EPVPECSDGAIHSWAVEGPQPEPRDITTVIPQIPPDNANIIECIDNSGVYTNEYGGREMQDLGGGERMTGFELTEGVKTSGMPEICQEYSG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DSG1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Desmoglein-1 Antibody (NBP3-17012)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DSG1 |
![Immunohistochemistry-Paraffin: Desmoglein-1 Antibody [NBP3-17012] - Staining of human skin shows high expression.](http://images.novusbio.com/fullsize/Desmoglein-1-Antibody-Immunohistochemistry-Paraffin-NBP3-17012-img0002.jpg "Immunohistochemistry-Paraffin: Desmoglein-1 Antibody [NBP3-17012] - Staining of human skin shows high expression.")
![Immunohistochemistry-Paraffin: Desmoglein-1 Antibody [NBP3-17012] - Staining of human stomach shows low expression as expected.](http://images.novusbio.com/fullsize/Desmoglein-1-Antibody-Immunohistochemistry-Paraffin-NBP3-17012-img0003.jpg "Immunohistochemistry-Paraffin: Desmoglein-1 Antibody [NBP3-17012] - Staining of human stomach shows low expression as expected.")
![Simple Western Desmoglein-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmoglein2_AF947_Simple_Western_20740.jpg)
![Western Blot Desmoglein-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmoglein2_AF947_Western_Blot_20147.jpg)
![Immunohistochemistry Corneodesmosin Antibody [Unconjugated]](https://images.novusbio.com/images2/Corneodesmosin_AF5725_Immunohistochemistry_7196.jpg)
![Western Blot Kallikrein 7 Antibody [Unconjugated]](https://images.novusbio.com/images2/Kallikrein_7_AF2624_Western_Blot_21474.jpg)
![Immunohistochemistry Kallikrein 7 Antibody [Unconjugated]](https://images.novusbio.com/images2/Kallikrein_7_AF2624_Immunohistochemistry_6755.jpg)
![Enzyme Activity Kallikrein 5 [Unconjugated]](https://images.novusbio.com/images2/Kallikrein_5_1108SE_1835.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")