Home » cGK2/PRKG2 » cGK2/PRKG2 Proteins » cGK2/PRKG2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

cGK2/PRKG2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for cGK2/PRKG2 Protein (NBP1-84497PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

cGK2/PRKG2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRKG2.

Source: E. coli

Amino Acid Sequence: REYHLKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRKG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84497.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for cGK2/PRKG2 Recombinant Protein Antigen

  • cGK 2
  • cGK2
  • cGK2/PRKG2
  • cGKII
  • cGKIIcGK2
  • cGMP-dependent protein kinase 2
  • cGMP-dependent protein kinase II
  • EC 2.7.11
  • PRKG2
  • PRKGR2
  • PRKGR2EC 2.7.11.12
  • protein kinase, cGMP-dependent, type II

Background

cGK2/PRKG2, also known as cGMP-dependent protein kinase 2, is 762 amino acids long and approximately 87kDa. cGK2/PRKG2 is a protein kinase that is highly expressed in the brain, intestine and lung. Current research surrounding cGK2/PRKG2 has shown a potential link with several disorders and diseases including cystic fibrosis, gout, malaria, lung cancer, alcoholism, diarrhea, and hyperphenylalaninemia. cGK2/PRKG2 may also interact with PTS, LASP1, YWHAB, MYLK, and PLCB3 in pathways such as cGMP signaling, platelet homeostasis, EDNRB signaling, signaling in gap junctions, nitric oxide metabolism, and eNOS activation and regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

cGK1/PRKG1 Antibody
NBP2-14843
Western Blot cGK1/PRKG1 Antibody
(1 Review)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus
(10 Reviews)
(76 Publications)
Species: Hu
Applications: IHC, IP, WB
Guanylin Antibody
NBP1-89724
Western Blot Guanylin Antibody
Immunohistochemistry-Paraffin Guanylin Antibody
Immunohistochemistry-Paraffin Guanylin Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Renin Antibody
(411507) - Propeptide
MAB4447
Immunohistochemistry Renin Antibody (411507) - Propeptide
(6 Publications)
Species: Hu
Applications: IHC, WB
SOX9 Antibody
[Unconjugated]
AF3075
Immunocytochemistry SOX9 Antibody [Unconjugated]
Western Blot SOX9 Antibody [Unconjugated]
Immunocytochemistry SOX9 Antibody [Unconjugated]
(2 Reviews)
(154 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
nNOS Antibody
NB100-858
Immunocytochemistry/ Immunofluorescence nNOS Antibody
Flow Cytometry nNOS Antibody
Immunocytochemistry/ Immunofluorescence nNOS Antibody
(1 Review)
(15 Publications)
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
beta Sarcoglycan
Antibody
NBP1-90300
Immunohistochemistry-Paraffin beta Sarcoglycan Antibody
Immunohistochemistry-Paraffin beta Sarcoglycan Antibody
Immunohistochemistry-Paraffin beta Sarcoglycan Antibody
(7 Publications)
Species: Hu
Applications: IHC, IHC-P
GSK-3 beta
Antibody (3D10) - BSA
NBP1-47470
Flow Cytometry GSK-3 beta Antibody (3D10) - BSA Free
Immunohistochemistry GSK-3 beta Antibody (3D10) - BSA Free
Immunocytochemistry/ Immunofluorescence GSK-3 beta Antibody (3D10) - BSA Free
(4 Reviews)
(10 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NHERF-2 Antibody
NB100-2450
Western Blot NHERF-2 Antibody
Immunohistochemistry-Paraffin NHERF-2 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Uroguanylin
Antibody
H00002981-D01P
Western Blot Uroguanylin Antibody
(1 Publication)
Species: Hu
Applications: WB
GluR1 Antibody
(S355-1)
NBP2-22399
Western Blot GluR1 Antibody (S355-1)
Immunocytochemistry/ Immunofluorescence GluR1 Antibody (S355-1)
Immunocytochemistry/ Immunofluorescence GluR1 Antibody (S355-1)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NHE3/SLC9A3
Antibody
NBP1-82574
Immunohistochemistry-Paraffin NHE3/SLC9A3 Antibody
Immunohistochemistry-Paraffin NHE3/SLC9A3 Antibody
Immunohistochemistry-Paraffin NHE3/SLC9A3 Antibody
(31 Publications)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PAGE, WB
NHERF-1 Antibody
NBP3-35065
NHERF-1 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, WB
CNPase Antibody
(CL2887)
NBP2-46617
Immunohistochemistry CNPase Antibody (CL2887)
Immunohistochemistry CNPase Antibody (CL2887)
Immunohistochemistry-Paraffin CNPase Antibody (CL2887)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GUCY2C Antibody
NBP1-81788
Immunohistochemistry-Paraffin GUCY2C Antibody
Immunohistochemistry-Paraffin GUCY2C Antibody
Immunohistochemistry-Paraffin GUCY2C Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
VASP Antibody
(OTI4D6)
NBP2-00555
Flow Cytometry VASP Antibody (OTI4D6)
Flow Cytometry VASP Antibody (OTI4D6)
Western Blot VASP Antibody (OTI4D6)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
cGK2/PRKG2
Recombinant Protein A
NBP1-84497PEP
cGK2/PRKG2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for cGK2/PRKG2 Protein (NBP1-84497PEP) (0)

There are no publications for cGK2/PRKG2 Protein (NBP1-84497PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for cGK2/PRKG2 Protein (NBP1-84497PEP) (0)

There are no reviews for cGK2/PRKG2 Protein (NBP1-84497PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for cGK2/PRKG2 Protein (NBP1-84497PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional cGK2/PRKG2 Products

Research Areas for cGK2/PRKG2 Protein (NBP1-84497PEP)

Find related products by research area.

Blogs on cGK2/PRKG2

There are no specific blogs for cGK2/PRKG2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our cGK2/PRKG2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PRKG2