Reactivity | Hu, MuSpecies Glossary |
Applications | WB, IHC, IP |
Clone | 10N2L6 |
Clonality | Monoclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Additional Information | Recombinant Monoclonal Antibody |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 129-228 of human CD9 (P21926). YNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV |
Isotype | IgG |
Clonality | Monoclonal |
Host | Rabbit |
Gene | CD9 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CD9 Antibody (NBP3-15593)Find related products by research area.
|
Glypican 3 as a biomarker for gastro-esophageal adenocarcinoma By Jamshed Arslan, Pharm. D., PhD. Gastroesophageal adenocarcinoma originates from the glandular epithelium of the esophagus, gastroesophageal junction and stomach. The incidence of gastroesophageal adenocarcinoma is ... Read full blog post. |
Tools for Isolation, Quantification and Analysis of Exosomes Exosomes are spherical to cup-shaped bilayered membrane enclosed nanosize vesicles (30-100 nm) which have the ability to shuttle active cargoes between cells. Johnstone et al. 1987 pioneered in documenting the generation of exosomes in differentiat... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CD9 |