Novus Biologicals products are now on bio-techne.com

CD40/TNFRSF5 Recombinant Protein Antigen

Images

 
There are currently no images for CD40/TNFRSF5 Protein (NBP2-33957PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

CD40/TNFRSF5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD40.

Source: E. coli

Amino Acid Sequence: EGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD40
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33957.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD40/TNFRSF5 Recombinant Protein Antigen

  • B cell surface antigen CD40
  • B-cell surface antigen CD40
  • Bp50B cell-associated molecule
  • CD40 antigen
  • CD40 molecule, TNF receptor superfamily member 5
  • CD40 type II isoform
  • CD40
  • CD40L receptor
  • CDw40
  • MGC9013
  • nerve growth factor receptor-related B-lymphocyte activation molecule
  • p50
  • TNFRSF5
  • TNFRSF5CD40 antigen (TNF receptor superfamily member 5)
  • tumor necrosis factor receptor superfamily member 5
  • tumor necrosis factor receptor superfamily, member 5

Background

CD40 and its ligand CD154 are members of the tumor necrosis factor receptor (TNFR) and TNF families, respectively, that play key roles in signaling pathways mediating cell growth, survival and differentiation in B-lymphocytes (reviewed in Quezada et al 2004). The CD40 receptor is a 45-50 kDa glycoprotein and is expressed on the surface of B-lymphocytes, some activated T-cells, monocytes, follicular dendritic cells, basal epithelial cells, and in some epithelial and non-epithelial carcinomas. The functions of CD40 have been most extensively studied in B-cells. Ligation of B CD40 by CD154, expressed on activated T cells, stimulates B cell proliferation, differentiation, isotype switching, upregulation of surface molecules contributing to antigen presentation, development of the germinal center, and the humoral memory response. Several distinct structural motifs in the CD40 cytoplasmic domain regaulate various CD40 signaling pathways. A major CD40 signaling pathway activated from CD154 ligand binding is the canonical pathway to the transcription factor family NF-kB, a family of genes mediating immune and inflammatory responses. Although CD40 has been extensively studied as a plasma membrane-associated growth factor membrane receptor. it has also been identified in the cytoplasm and nucleus of normal and neoplastic B-lymphoid cells (Lin-Lee et al. 2006). Other growth factor receptors, including EGF, FGF, and TGF-B have also been identified in the nuclus. It is thought that plasma membrane receptor signaling may be followed by nuclear migration of signaling pathway components. The presence of CD40 in the nucleus of activated normal B lymphocytes and neoplastic B-lymphoid cells suggests that CD40 may play a more complex role in regulating essential growth and survival pathways in B-lymphocytes than previously thought.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DCDL40
Species: Hu
Applications: ELISA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
7268-CT
Species: Hu
Applications: BA
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
MAB4364
Species: Rt
Applications: ICC, IHC, IP, KO, WB
AF2849
Species: Mu, Rt
Applications: WB
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DY417
Species: Mu
Applications: ELISA
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
M6000B
Species: Mu
Applications: ELISA
202-IL
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF796
Species: Mu
Applications: AdBlk, IHC, WB

Publications for CD40/TNFRSF5 Protein (NBP2-33957PEP) (0)

There are no publications for CD40/TNFRSF5 Protein (NBP2-33957PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD40/TNFRSF5 Protein (NBP2-33957PEP) (0)

There are no reviews for CD40/TNFRSF5 Protein (NBP2-33957PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD40/TNFRSF5 Protein (NBP2-33957PEP). (Showing 1 - 2 of 2 FAQ).

  1. I wanna know does CD40 antibody for IHC-P comes with positive control slide?
    • Our CD40 antibodies do not come with positive control slides however you can use any type of primary carcinoma cell as a positive control. I recommend breast carcinoma as this is what we have tested our CD40 antibodies on.
  2. We are studying CD40L in our system. It has been known that both CD40 and CD11b are receptors for CD40L. We need CD40 antibody to neutralize CD40 binding to CD40L, then we may prove what is function for CD11b binding to CD40L. Do you have any CD40 Ab which has block function only between CD40 and CD40L, but not between CD11b and CD40L?
    • Unfortunately, none of our CD40 antibodies have been specifically tested for this application.

Additional CD40/TNFRSF5 Products

Research Areas for CD40/TNFRSF5 Protein (NBP2-33957PEP)

Find related products by research area.

Blogs on CD40/TNFRSF5

There are no specific blogs for CD40/TNFRSF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD40/TNFRSF5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD40