CD40/TNFRSF5 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD40. Source: E. coli
Amino Acid Sequence: EGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
CD40 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33957. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here. |
Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for CD40/TNFRSF5 Recombinant Protein Antigen
Background
CD40 and its ligand CD154 are members of the tumor necrosis factor receptor (TNFR) and TNF families, respectively, that play key roles in signaling pathways mediating cell growth, survival and differentiation in B-lymphocytes (reviewed in Quezada et al 2004). The CD40 receptor is a 45-50 kDa glycoprotein and is expressed on the surface of B-lymphocytes, some activated T-cells, monocytes, follicular dendritic cells, basal epithelial cells, and in some epithelial and non-epithelial carcinomas. The functions of CD40 have been most extensively studied in B-cells. Ligation of B CD40 by CD154, expressed on activated T cells, stimulates B cell proliferation, differentiation, isotype switching, upregulation of surface molecules contributing to antigen presentation, development of the germinal center, and the humoral memory response. Several distinct structural motifs in the CD40 cytoplasmic domain regaulate various CD40 signaling pathways. A major CD40 signaling pathway activated from CD154 ligand binding is the canonical pathway to the transcription factor family NF-kB, a family of genes mediating immune and inflammatory responses. Although CD40 has been extensively studied as a plasma membrane-associated growth factor membrane receptor. it has also been identified in the cytoplasm and nucleus of normal and neoplastic B-lymphoid cells (Lin-Lee et al. 2006). Other growth factor receptors, including EGF, FGF, and TGF-B have also been identified in the nuclus. It is thought that plasma membrane receptor signaling may be followed by nuclear migration of signaling pathway components. The presence of CD40 in the nucleus of activated normal B lymphocytes and neoplastic B-lymphoid cells suggests that CD40 may play a more complex role in regulating essential growth and survival pathways in B-lymphocytes than previously thought.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Mu, Rt
Applications: WB
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: AdBlk, IHC, WB
Publications for CD40/TNFRSF5 Protein (NBP2-33957PEP) (0)
There are no publications for CD40/TNFRSF5 Protein (NBP2-33957PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD40/TNFRSF5 Protein (NBP2-33957PEP) (0)
There are no reviews for CD40/TNFRSF5 Protein (NBP2-33957PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Additional CD40/TNFRSF5 Products
Research Areas for CD40/TNFRSF5 Protein (NBP2-33957PEP)
Find related products by research area.
|
Blogs on CD40/TNFRSF5