![Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33969] - Analysis in human lymph node and skeletal muscle tissues. Corresponding CD37 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CD37-Antibody-Immunohistochemistry-Paraffin-NBP2-33969-img0020.jpg "Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33969] - Analysis in human lymph node and skeletal muscle tissues. Corresponding CD37 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CD37 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CD37 Antibody (NBP2-33969)Find related products by research area.
|
|
CD81/TAPA1: I'm on Tapa the Cell Target of the antiproliferative 1 (TAPA1), also known as CD81, is found in the plasma membrane in lymphocytes and plays an important role in the regulation of lymphoma cell growth. This transmembrane 4 superfamily (TM4SF) protein is primarily found on... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33969] - Staining of human cerebral cortex, lymph node, skeletal muscle and tonsil using Anti-CD37 antibody NBP2-33969 (A) shows similar protein distribution across tissues to independent antibody NBP2-33970 (B).](http://images.novusbio.com/fullsize/CD37-Antibody-Immunohistochemistry-Paraffin-NBP2-33969-img0023.jpg "Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33969] - Staining of human cerebral cortex, lymph node, skeletal muscle and tonsil using Anti-CD37 antibody NBP2-33969 (A) shows similar protein distribution across tissues to independent antibody NBP2-33970 (B).")
![Western Blot: CD37 Antibody [NBP2-33969] - Analysis in human cell line Daudi.](http://images.novusbio.com/fullsize/CD37-Antibody-Western-Blot-NBP2-33969-img0026.jpg "Western Blot: CD37 Antibody [NBP2-33969] - Analysis in human cell line Daudi.")
![Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33969] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/CD37-Antibody-Immunohistochemistry-Paraffin-NBP2-33969-img0025.jpg "Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33969] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33969] - Staining of human tonsil shows high expression.](http://images.novusbio.com/fullsize/CD37-Antibody-Immunohistochemistry-Paraffin-NBP2-33969-img0009.jpg "Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33969] - Staining of human tonsil shows high expression.")
![Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33969] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/CD37-Antibody-Immunohistochemistry-Paraffin-NBP2-33969-img0021.jpg "Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33969] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33969] - Staining of human lymph node shows strong membranous positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/CD37-Antibody-Immunohistochemistry-Paraffin-NBP2-33969-img0024.jpg "Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33969] - Staining of human lymph node shows strong membranous positivity in non-germinal center cells.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neprilysin_AF1126_Immunohistochemistry_6679.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-8220249505976.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-44202415433122.jpg)
![Immunocytochemistry CD23/Fc epsilon RII Antibody [Unconjugated]](https://images.novusbio.com/images2/CD23_AF123_Immunocytochemistry_6469.jpg)
![Immunohistochemistry ICAM-1/CD54 Antibody [Unconjugated]](https://images.novusbio.com/images2/ICAM1_AF796_Immunohistochemistry_17354.jpg)
![Western Blot ICAM-1/CD54 Antibody [Unconjugated]](https://images.novusbio.com/images/af796_mouse-icam-1-cd54-affinity-purified-polyclonal-ab-4120241048112.jpg)
![Western Blot ICAM-1/CD54 Antibody [Unconjugated]](https://images.novusbio.com/images/af796_mouse-icam-1-cd54-affinity-purified-polyclonal-ab-41202410481112.jpg)
![Western Blot TSPAN8/TM4SF3 Antibody (458811) [Unconjugated]](https://images.novusbio.com/images2/TSPAN8_MAB4734_Western_Blot_11031.jpg)
![Flow Cytometry TSPAN8/TM4SF3 Antibody (458811) [Unconjugated]](https://images.novusbio.com/images2/TSPAN8_MAB4734_Flow_Cytometry_8501.jpg)
![Immunocytochemistry TSPAN8/TM4SF3 Antibody (458811) [Unconjugated]](https://images.novusbio.com/images2/TSPAN8_MAB4734_Immunocytochemistry_9894.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")