CC Chemokine Receptor D6 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ACKR2 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for CC Chemokine Receptor D6 Antibody
Background
Chemokine Receptor D6 encodes a beta chemokine receptor similar to G protein-coupled receptors. Chemokines and their receptor-mediated signal transduction are critical for the recruitment of effector immune cells to the inflammation site. This receptor appears to bind the majority of beta-chemokine family members; however, its specific function remains unknown.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: BA
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Mu
Applications: Neut, WB
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: ELISA
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: IHC
Publications for CC Chemokine Receptor D6 Antibody (NBP1-88150) (0)
There are no publications for CC Chemokine Receptor D6 Antibody (NBP1-88150).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CC Chemokine Receptor D6 Antibody (NBP1-88150) (0)
There are no reviews for CC Chemokine Receptor D6 Antibody (NBP1-88150).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CC Chemokine Receptor D6 Antibody (NBP1-88150) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CC Chemokine Receptor D6 Products
Research Areas for CC Chemokine Receptor D6 Antibody (NBP1-88150)
Find related products by research area.
|
Blogs on CC Chemokine Receptor D6