![Immunocytochemistry/Immunofluorescence: C1GALT1 Antibody [NBP1-88476] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies & cytosol.](http://images.novusbio.com/fullsize/C1GALT1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88476-img0004.jpg "Immunocytochemistry/Immunofluorescence: C1GALT1 Antibody [NBP1-88476] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies & cytosol.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDS |
| Predicted Species | Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C1GALT1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Glucosaminyl (N-acetyl) Transferase 1/GCNT1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GCNT1_AF7248_Immunohistochemistry_22592.jpg)
![Immunocytochemistry Glucosaminyl (N-acetyl) Transferase 1/GCNT1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GCNT1_AF7248_Immunocytochemistry_12684.jpg)
![Western Blot Glucosaminyl (N-acetyl) Transferase 1/GCNT1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GCNT1_AF7248_Western_Blot_12747.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C1GALT1 |
![Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88476] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/C1GALT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88476-img0015.jpg "Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88476] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88476] - Staining of human cerebral cortex shows strong positivity in neuropil.](http://images.novusbio.com/fullsize/C1GALT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88476-img0010.jpg "Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88476] - Staining of human cerebral cortex shows strong positivity in neuropil.")
![Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88476] - Staining of human cerebral cortex, kidney, liver and parathyroid gland using Anti-C1GALT1 antibody NBP1-88476 (A) shows similar protein distribution across tissues to independent antibody NBP1-88477 (B).](http://images.novusbio.com/fullsize/C1GALT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88476-img0011.jpg "Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88476] - Staining of human cerebral cortex, kidney, liver and parathyroid gland using Anti-C1GALT1 antibody NBP1-88476 (A) shows similar protein distribution across tissues to independent antibody NBP1-88477 (B).")
![Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88476] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/C1GALT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88476-img0012.jpg "Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88476] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88476] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/C1GALT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88476-img0013.jpg "Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88476] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88476] - Staining of human parathyroid gland shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/C1GALT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88476-img0014.jpg "Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88476] - Staining of human parathyroid gland shows strong cytoplasmic positivity in glandular cells.")
![Western Blot Galectin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin3_AF1197_Western_Blot_21471.jpg)
![Immunohistochemistry Galectin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-3_AF1197_Immunohistochemistry_7115.jpg)
![Simple Western Galectin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin3_AF1197_Simple_Western_18971.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/CCL2_DCP00_ELISA_67.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_633.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_634.jpg)
![Immunohistochemistry Plexin D1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_D1_AF4160_Immunohistochemistry_11521.jpg)
![Flow Cytometry Plexin D1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_D1_AF4160_Flow_Cytometry_8234.jpg)
![Neutralization Plexin D1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_D1_AF4160_Block_Neutralize_14419.jpg)
![Western Blot Podoplanin Antibody [Unconjugated]](https://images.novusbio.com/images2/Podoplanin_AF3244_Western_Blot_16905.jpg)
![Immunohistochemistry Podoplanin Antibody [Unconjugated]](https://images.novusbio.com/images2/Podoplanin_AF3244_Immunohistochemistry_9951.jpg)
![Immunocytochemistry/ Immunofluorescence Podoplanin Antibody [Unconjugated]](https://images.novusbio.com/images/af3244_mouse-podoplanin-affinity-purified-polyclonal-ab-4120241049442.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")