C1D Antibody (4H5) Summary
Immunogen |
C1D (AAH16284, 1 a.a. ~ 141 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS |
Specificity |
C1D - nuclear DNA-binding protein (4H5) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
C1D |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for C1D Antibody (4H5)
Background
The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Several alternatively spliced transcript variants of this gene have been described, but the full length nature of some of these variants has not been determined. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF
Publications for C1D Antibody (H00010438-M10) (0)
There are no publications for C1D Antibody (H00010438-M10).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for C1D Antibody (H00010438-M10) (0)
There are no reviews for C1D Antibody (H00010438-M10).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for C1D Antibody (H00010438-M10) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional C1D Products
Research Areas for C1D Antibody (H00010438-M10)
Find related products by research area.
|
Blogs on C1D