![Sandwich ELISA: ATP8B4 Antibody (4D5) [H00079895-M08] - Detection limit for recombinant GST tagged ATP8B4 is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ATP8B4-Antibody-4D5-Sandwich-ELISA-H00079895-M08-img0001.jpg "Sandwich ELISA: ATP8B4 Antibody (4D5) [H00079895-M08] - Detection limit for recombinant GST tagged ATP8B4 is 0.3 ng/ml as a capture antibody.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 4D5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | ATP8B4 (NP_079113.2, 401 a.a. ~ 488 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IMTFKRCSINGRIYGEVHDDLDQKTEITQEKEPVDFSVKSQADREFQFFDHHLMESIKMGDPKVHEFLRLLALCHTVMSEENSAGELI |
| Specificity | ATP8B4 - ATPase, Class I, type 8B, member 4 (4D5) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ATP8B4 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Western_Blot_5226.jpg)
![Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/16351.jpg)
![Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Flow_Cytometry_8189.jpg)
![Western Blot DRAK2 Antibody (685228) [Unconjugated]](https://images.novusbio.com/images2/DRAK2_MAB6640_Western_Blot_10597.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
