Home » ASCL3 » ASCL3 Proteins » ASCL3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ASCL3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ASCL3 Protein (NBP1-88635PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ASCL3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASCL3.

Source: E. coli

Amino Acid Sequence: NSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ASCL3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88635.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ASCL3 Recombinant Protein Antigen

  • achaete-scute complex homolog 3 (Drosophila)
  • ASH-3
  • bHLH transcription factor Sgn-1 (Salivary Glands 1)
  • bHLH transcriptional regulator Sgn-1
  • BHLHA42
  • bHLHa42achaete-scute homolog 3
  • Class A basic helix-loop-helix protein 42
  • hASH3
  • HASH3achaete-scute complex (Drosophila) homolog-like 3
  • Sgn1

Background

Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RPLP2 Antibody
NBP2-15104
Immunocytochemistry/ Immunofluorescence RPLP2 Antibody
Immunohistochemistry-Paraffin RPLP2 Antibody
Western Blot RPLP2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

FABP8/M-FABP/Myelin P2
AF5866
Western Blot FABP8/M-FABP/Myelin P2 Protein Antibody
Immunohistochemistry FABP8/M-FABP/Myelin P2 Protein Antibody
Immunohistochemistry FABP8/M-FABP/Myelin P2 Protein Antibody
Species: Hu
Applications: IHC, WB
Exosome component
10 Antibody
NBP1-32870
Western Blot Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
Western Blot Exosome component 10 Antibody
(2 Reviews)
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
MIST1 Antibody
(6E8/A12/C11P1)
NBP2-22478
Immunohistochemistry-Paraffin MIST1 Antibody (6E8/A12/C11P1)
Immunohistochemistry MIST1 Antibody (6E8/A12/C11P1)
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Perilipin-2/ADFP
Antibody - BSA Free
NB110-40877
Immunohistochemistry Perilipin-2/ADFP Antibody - BSA Free
Dual RNAscope ISH-IHC Perilipin-2/ADFP Antibody - BSA Free
Western Blot Perilipin-2/ADFP Antibody - BSA Free
(1 Review)
(64 Publications)
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
ASCL4 Antibody -
Azide and BSA Free
NBP2-92741
Immunohistochemistry-Paraffin ASCL4 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin ASCL4 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin ASCL4 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
eIF4G1 Antibody
NB100-268
Western Blot eIF4G1 Antibody
Immunoprecipitation eIF4G1 Antibody
(26 Publications)
Species: Hu, Po
Applications: IP, WB
ACSL6 Antibody
NBP2-15253
Western Blot ACSL6 Antibody
(1 Review)
Species: Mu, Rt
Applications: WB
PIN4 Antibody
(OTI7H2)
NBP2-46420
Immunohistochemistry PIN4 Antibody (OTI7H2)
Immunohistochemistry PIN4 Antibody (OTI7H2)
Immunohistochemistry PIN4 Antibody (OTI7H2)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
ACSL1 Antibody
NBP1-89270
Immunocytochemistry/ Immunofluorescence ACSL1 Antibody
Immunohistochemistry-Paraffin ACSL1 Antibody
Western Blot ACSL1 Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
FACL4 Antibody
NBP2-16401
Immunocytochemistry/ Immunofluorescence FACL4 Antibody
Immunocytochemistry/ Immunofluorescence FACL4 Antibody
Immunohistochemistry-Paraffin FACL4 Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Lipin 1 Antibody -
BSA Free
NB110-57150
Western Blot Lipin 1 Antibody - BSA Free
Immunohistochemistry Lipin 1 Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
SS18L1 Antibody
NBP2-20486
Immunoprecipitation SS18L1 Antibody
Immunohistochemistry-Paraffin SS18L1 Antibody
Immunocytochemistry/ Immunofluorescence SS18L1 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Cytokeratin 5
Antibody - BSA Free
NBP2-61931
Immunocytochemistry/ Immunofluorescence Cytokeratin 5 Antibody - BSA Free
Western Blot Cytokeratin 5 Antibody - BSA Free
Immunohistochemistry-Paraffin Cytokeratin 5 Antibody - BSA Free
(2 Publications)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PABP Antibody
(10E10) - BSA Free
NB120-6125
Flow Cytometry PABP Antibody (10E10) - BSA Free
Western Blot PABP Antibody (10E10) - BSA Free
Western Blot PABP Antibody (10E10) - BSA Free
(1 Review)
(11 Publications)
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB
MCM4 Antibody
NBP1-33105
Immunocytochemistry/ Immunofluorescence MCM4 Antibody
Immunohistochemistry-Paraffin MCM4 Antibody
Western Blot MCM4 Antibody
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
FABP3/H-FABP
Antibody (242305) [Un ...
MAB1678
Western Blot FABP3/H-FABP Antibody (242305) [Unconjugated]
Immunohistochemistry FABP3/H-FABP Antibody (242305) [Unconjugated]
Simple Western FABP3/H-FABP Antibody (242305) [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
ASCL3 Recombinant
Protein Antigen
NBP1-88635PEP
ASCL3 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ASCL3 Protein (NBP1-88635PEP) (0)

There are no publications for ASCL3 Protein (NBP1-88635PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASCL3 Protein (NBP1-88635PEP) (0)

There are no reviews for ASCL3 Protein (NBP1-88635PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ASCL3 Protein (NBP1-88635PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ASCL3 Products

Blogs on ASCL3

There are no specific blogs for ASCL3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

ADFP antibody was tested in mouse liver using DAB with hematoxylin counterstain.
Perilipin-2/ADFP Antibody - BSA Free
NB110-40877
Flow Cytometry: PABP Antibody (10E10) [NB120-6125] - An intracellular stain was performed on A431 cells with PABP [10E10] Antibody NB120-6125AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
PABP Antibody (10E10) - BSA Free
NB120-6125

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ASCL3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ASCL3