![Western Blot: ASCL3 Antibody (2F8) [H00056676-M02-100ug] - detection against Immunogen (36.19 KDa) .](http://images.novusbio.com/fullsize/ASCL3-Antibody-2F8-Western-Blot-H00056676-M02-100ug-img0001.jpg "Western Blot: ASCL3 Antibody (2F8) [H00056676-M02-100ug] - detection against Immunogen (36.19 KDa) .")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 2F8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | ASCL3 (NP_065697.1, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFT |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ASCL3 |
| Purity | Protein A or G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A or G purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ASCL3 |
| Entrez |
|
| OMIM |
|
| Uniprot |
|
![Western Blot FABP3/H-FABP Antibody (242305) [Unconjugated]](https://images.novusbio.com/images2/FABP3_MAB1678_Western_Blot_5986.jpg)
![Immunohistochemistry FABP3/H-FABP Antibody (242305) [Unconjugated]](https://images.novusbio.com/images2/FABP3_MAB1678_Immunohistochemistry_11974.jpg)
![Simple Western FABP3/H-FABP Antibody (242305) [Unconjugated]](https://images.novusbio.com/images2/FABP3_MAB1678_Simple_Western_20571.jpg)
