Home » AMPK alpha 1 » AMPK alpha 1 Proteins » AMPK alpha 1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

AMPK alpha 1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for AMPK alpha 1 Recombinant Protein Antigen (NBP2-58302PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

AMPK alpha 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRKAA1.

Source: E. coli

Amino Acid Sequence: NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRKAA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58302.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AMPK alpha 1 Recombinant Protein Antigen

  • AMP -activate kinase alpha 1 subunit
  • AMP-activated protein kinase, catalytic, alpha-1,5'-AMP-activated protein kinase catalytic subunit alpha-1
  • AMPK alpha 1
  • AMPK alpha 1,5'-AMP-activated protein kinase, catalytic alpha-1 chain
  • AMPK subunit alpha-1
  • AMPK
  • AMPK1
  • AMPKa1
  • EC 2.7.11
  • EC 2.7.11.1
  • MGC33776
  • MGC57364
  • PRKAA1
  • protein kinase, AMP-activated, alpha 1 catalytic subunit

Background

The 5'-AMP-activated protein kinase (AMPK), a member of the SNF1 (sucrose non-fermentor) kinase family (1) AMPK is a heterotrimeric protein comprising alpha (63 kDa), beta (38 kDa) and gamma (38 kDa) subunits. The alpha subunit is the catalytic subunit (which requires phosphorylation to be active) (2-3). Beta and gamma are non-catalytic subunits, although they have been found to interact with the active subunit in liver. AMPK regulates fatty acid and sterol synthesis by phosphorylation of acetyl-CoA as well as cholesterol synthesis via phosphorylation and inactivation of hydroxymethylglutaryl-CoA reductase (4). AMPK also appears to play a role in protecting cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
LKB1/STK11
Antibody - BSA Free
NBP2-14835
Western Blot LKB1/STK11 Antibody - BSA Free
Immunohistochemistry-Paraffin LKB1/STK11 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence LKB1/STK11 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ATIC Antibody
NBP1-89192
Western Blot ATIC Antibody
Western Blot ATIC Antibody
Immunohistochemistry-Paraffin ATIC Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Adiponectin/Acrp30
[HRP]
DRP300
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
(186 Publications)
Species: Hu
Applications: ELISA
Acetyl-CoA
Carboxylase alpha/ACA ...
MAB6898
Western Blot Acetyl-CoA Carboxylase alpha/ACACA Antibody (738421)
(3 Publications)
Species: Hu, Mu
Applications: WB
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular) Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
(4 Reviews)
(41 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Sirtuin 1/SIRT1
Antibody (1F3) - BSA ...
NBP1-51641
Immunohistochemistry-Paraffin Sirtuin 1/SIRT1 Antibody (1F3) - BSA Free
Flow Cytometry Sirtuin 1/SIRT1 Antibody (1F3) - BSA Free
Immunocytochemistry/ Immunofluorescence Sirtuin 1/SIRT1 Antibody (1F3) - BSA Free
(9 Publications)
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(155 Publications)
Species: Hu
Applications: ELISA
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
eNOS Antibody -
BSA Free
NB300-500
Western Blot eNOS Antibody - BSA Free
Immunohistochemistry-Paraffin eNOS Antibody - BSA Free
Immunohistochemistry-Paraffin eNOS Antibody - BSA Free
(3 Reviews)
(28 Publications)
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
AMPK alpha 2
Antibody [Unconjugate
AF2850
Western Blot AMPK alpha 2 Antibody [Unconjugated]
Simple Western AMPK alpha 2 Antibody [Unconjugated]
Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Ribosomal Protein
S6/RPS6 Antibody
NB100-1595
Immunohistochemistry-Paraffin Ribosomal Protein S6/RPS6 Antibody
Western Blot Ribosomal Protein S6/RPS6 Antibody
Immunoprecipitation Ribosomal Protein S6/RPS6 Antibody
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(661 Publications)
Species: Mu
Applications: ELISA
Fatty Acid
Synthase/FASN Antibod
NB400-114
Immunocytochemistry/ Immunofluorescence Fatty Acid Synthase/FASN Antibody
Western Blot Fatty Acid Synthase/FASN Antibody
Immunohistochemistry-Paraffin Fatty Acid Synthase/FASN Antibody
(2 Reviews)
(27 Publications)
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
AMPK alpha 1
Recombinant Protein A ...
NBP2-58302PEP
AMPK alpha 1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for AMPK alpha 1 Recombinant Protein Antigen (NBP2-58302PEP) (0)

There are no publications for AMPK alpha 1 Recombinant Protein Antigen (NBP2-58302PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMPK alpha 1 Recombinant Protein Antigen (NBP2-58302PEP) (0)

There are no reviews for AMPK alpha 1 Recombinant Protein Antigen (NBP2-58302PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AMPK alpha 1 Recombinant Protein Antigen (NBP2-58302PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AMPK alpha 1 Products

Research Areas for AMPK alpha 1 Recombinant Protein Antigen (NBP2-58302PEP)

Find related products by research area.

Blogs on AMPK alpha 1.

Check out the latest blog posts on AMPK alpha 1.
AMPK Alpha 1 and lipid metabolism of adipocytes
AMP-activated protein kinase (AMPK) is best known as a sensor of oxidative stress.  AMPK is activated by increased intracellular AMP levels, which are a result of alterations in cellular metabolism from causes such as hypoxia, changes in ATP, sene...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AMPK alpha 1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PRKAA1