![Western Blot: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Analysis in control (vector only transfected HEK293T lysate) and ADH5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-5-Antibody-Western-Blot-NBP2-49350-img0003.jpg "Western Blot: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Analysis in control (vector only transfected HEK293T lysate) and ADH5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSI |
| Predicted Species | Mouse (90%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ADH5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Validated in Simple Western (PMID: 32026202) |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Publication using NBP2-49350 | Applications | Species |
|---|---|---|
| Pini, T.; Parks, J.; Russ, J.; Dzieciatkowska, M.; Hansen, K.C.; Schoolcraft, W.B.; Katz-Jaffe, M. Obesity Significantly Alters the Human Sperm Proteome, With Potential Implications for Fertility J Assist Reprod Genet [PMID: 32026202] (Simple Western, Human) | Simple Western | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for alcohol dehydrogenase 5 Antibody (NBP2-49350)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ADH5 |
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Staining of human skeletal muscle shows low positivity in myocytes as expected.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-5-Antibody-Immunohistochemistry-Paraffin-NBP2-49350-img0007.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Staining of human skeletal muscle shows low positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Analysis in human endometrium and skeletal muscle tissues. Corresponding ADH5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-5-Antibody-Immunohistochemistry-Paraffin-NBP2-49350-img0004.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Analysis in human endometrium and skeletal muscle tissues. Corresponding ADH5 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-5-Antibody-Immunohistochemistry-Paraffin-NBP2-49350-img0005.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-5-Antibody-Immunohistochemistry-Paraffin-NBP2-49350-img0006.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-5-Antibody-Immunohistochemistry-Paraffin-NBP2-49350-img0008.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in Leydig cells.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")