![Western Blot: Lysyl tRNA synthetase Antibody [NBP1-87706] - Analysis using Anti-KARS antibody NBP1-87706 (A) shows similar pattern to independent antibody NBP1-87705 (B).](http://images.novusbio.com/fullsize/Lysyl-tRNA-synthetase-Antibody-Western-Blot-NBP1-87706-img0010.jpg "Western Blot: Lysyl tRNA synthetase Antibody [NBP1-87706] - Analysis using Anti-KARS antibody NBP1-87706 (A) shows similar pattern to independent antibody NBP1-87705 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KARS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KARS1 |
![Immunocytochemistry/Immunofluorescence: Lysyl tRNA synthetase Antibody [NBP1-87706] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Lysyl-tRNA-synthetase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87706-img0007.jpg "Immunocytochemistry/Immunofluorescence: Lysyl tRNA synthetase Antibody [NBP1-87706] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody [NBP1-87706] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/Lysyl-tRNA-synthetase-Antibody-Immunohistochemistry-Paraffin-NBP1-87706-img0013.jpg "Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody [NBP1-87706] - Staining of human cerebral cortex.")
![Western Blot: Lysyl tRNA synthetase Antibody [NBP1-87706] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Lysyl-tRNA-synthetase-Antibody-Western-Blot-NBP1-87706-img0008.jpg "Western Blot: Lysyl tRNA synthetase Antibody [NBP1-87706] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody [NBP1-87706] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/Lysyl-tRNA-synthetase-Antibody-Immunohistochemistry-Paraffin-NBP1-87706-img0002.jpg "Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody [NBP1-87706] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody [NBP1-87706] - Staining of human cerebral cortex, colon, kidney and testis using Anti-KARS antibody NBP1-87706 (A) shows similar protein distribution across tissues to independent antibody NBP1-87705 (B).](http://images.novusbio.com/fullsize/Lysyl-tRNA-synthetase-Antibody-Immunohistochemistry-Paraffin-NBP1-87706-img0009.jpg "Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody [NBP1-87706] - Staining of human cerebral cortex, colon, kidney and testis using Anti-KARS antibody NBP1-87706 (A) shows similar protein distribution across tissues to independent antibody NBP1-87705 (B).")
![Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody [NBP1-87706] - Staining of human colon.](http://images.novusbio.com/fullsize/Lysyl-tRNA-synthetase-Antibody-Immunohistochemistry-Paraffin-NBP1-87706-img0011.jpg "Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody [NBP1-87706] - Staining of human colon.")
![Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody [NBP1-87706] - Staining of human kidney.](http://images.novusbio.com/fullsize/Lysyl-tRNA-synthetase-Antibody-Immunohistochemistry-Paraffin-NBP1-87706-img0012.jpg "Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody [NBP1-87706] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody [NBP1-87706] - Staining of human testis.](http://images.novusbio.com/fullsize/Lysyl-tRNA-synthetase-Antibody-Immunohistochemistry-Paraffin-NBP1-87706-img0014.jpg "Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody [NBP1-87706] - Staining of human testis.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Simple Western p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/16324.jpg)
![Western Blot p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Western_Blot_22371.jpg)
![Immunohistochemistry p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Immunohistochemistry_7087.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")