![Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis using Anti-UQCRFS1 antibody NBP1-87826 (A) shows similar pattern to independent antibody NBP2-38623 (B).](http://images.novusbio.com/fullsize/UQCRFS1-Antibody-Western-Blot-NBP1-87826-img0025.jpg "Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis using Anti-UQCRFS1 antibody NBP1-87826 (A) shows similar pattern to independent antibody NBP2-38623 (B).")
| Reactivity | Hu, Rt, MuSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV |
| Predicted Species | Mouse (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UQCRFS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in the literature (PMID:25605331). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot FADD [p Ser194] Antibody (709736)](https://images.novusbio.com/images2/FADD_MAB7047_Western_Blot_11404.jpg)
![Immunocytochemistry FADD [p Ser194] Antibody (709736)](https://images.novusbio.com/images2/FADD_MAB7047_Immunocytochemistry_11450.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for UQCRFS1 Antibody (NBP1-87826)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UQCRFS1 |
![Immunocytochemistry/Immunofluorescence: UQCRFS1 Antibody [NBP1-87826] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/UQCRFS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87826-img0023.jpg "Immunocytochemistry/Immunofluorescence: UQCRFS1 Antibody [NBP1-87826] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human testis using Anti-UQCRFS1 antibody NBP1-87826.](http://images.novusbio.com/fullsize/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0029.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human testis using Anti-UQCRFS1 antibody NBP1-87826.")
![Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in human cell line A-549.](http://images.novusbio.com/fullsize/UQCRFS1-Antibody-Western-Blot-NBP1-87826-img0010.jpg "Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in human cell line A-549.")
![Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/UQCRFS1-Antibody-Western-Blot-NBP1-87826-img0011.jpg "Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0018.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0019.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0020.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.](http://images.novusbio.com/fullsize/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0021.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.")
![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining in human heart muscle and pancreas tissues . Corresponding UQCRFS1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0022.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining in human heart muscle and pancreas tissues . Corresponding UQCRFS1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human colon, kidney, liver and testis using Anti-UQCRFS1 antibody NBP1-87826 (A) shows similar protein distribution across tissues to independent antibody NBP2-38623 (B).](http://images.novusbio.com/fullsize/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0024.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human colon, kidney, liver and testis using Anti-UQCRFS1 antibody NBP1-87826 (A) shows similar protein distribution across tissues to independent antibody NBP2-38623 (B).")
![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human liver.](http://images.novusbio.com/fullsize/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0026.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human liver.")
![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human colon.](http://images.novusbio.com/fullsize/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0027.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human colon.")
![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human kidney using Anti-UQCRFS1 antibody NBP1-87826.](http://images.novusbio.com/fullsize/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0028.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human kidney using Anti-UQCRFS1 antibody NBP1-87826.")
![Simple Western: UQCRFS1 Antibody [NBP1-87826] - Simple Western lane view shows a specific band for RIP1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/UQCRFS1-Antibody-Simple-Western-NBP1-87826-img0007.jpg "Simple Western: UQCRFS1 Antibody [NBP1-87826] - Simple Western lane view shows a specific band for RIP1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: UQCRFS1 Antibody [NBP1-87826] - Electropherogram image(s) of corresponding Simple Western lane view. UQCRFS1 antibody was used at 1:30 dilution on RT-4 and U-251MG lysate(s).](http://images.novusbio.com/fullsize/UQCRFS1-Antibody-Simple-Western-NBP1-87826-img0009.jpg "Simple Western: UQCRFS1 Antibody [NBP1-87826] - Electropherogram image(s) of corresponding Simple Western lane view. UQCRFS1 antibody was used at 1:30 dilution on RT-4 and U-251MG lysate(s).")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_815.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_816.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/TNF_RI_DRT100_ELISA_175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")