Home » SOD2/Mn-SOD » SOD2 Peptides and Proteins » SOD2/Mn-SOD Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SOD2/Mn-SOD Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SOD2/Mn-SOD Protein (NBP1-86169PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SOD2/Mn-SOD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SOD2.

Source: E. coli

Amino Acid Sequence: VCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SOD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86169.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SOD2/Mn-SOD Recombinant Protein Antigen

  • EC 1.15.1.1
  • indophenoloxidase B
  • IPOB
  • IPO-B
  • manganese-containing superoxide dismutase
  • mangano-superoxide dismutase
  • Mn SOD
  • Mn superoxide dismutase
  • MnSOD
  • MVCD6
  • SOD, Mitochodrial
  • SOD2
  • superoxide dismutase [Mn], mitochondrial
  • superoxide dismutase 2, mitochondrial

Background

Superoxide dismutase (SOD) is responsible for the elimination of cytotoxic active oxygen by catalyzing the dismutation of the superoxide radical to oxygen and hydrogen peroxide (1, 2, 3). There are three SOD isoenzymes in mammalian cells. They are: extracellular SOD (EC SOD), copper and zinc-containing SOD (CuZn SOD) and manganese-containing SOD (Mn SOD, SOD-2). The CuZn form contains Cu and Zn ions and exists as a 32 kDa dimer in the cytosol. Mn SOD is an 80 kDa tetramer that contains Mn ion and resides in the mitochondrial matrix. Mn SOD is a tumor necrosis factor (TNF)-inducible enzyme that protects cells from NFmediated apoptosis (4) via superoxide anion detoxification and the subsequent regulation of apoptosis through cytochrome c release and the modulation of the redox state of the mitochondria (6). Mn SOD has also been shown to be a tumor suppressor in human breast cancer (7). Overexpression of this enzyme protects neurons from NMDAand nitric oxide-induced neurotoxicity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot SOD1/Cu-Zn SOD Antibody
Western Blot SOD1/Cu-Zn SOD Antibody
Immunohistochemistry-Paraffin SOD1/Cu-Zn SOD Antibody
(3 Reviews)
(20 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(807 Publications)
Species: Hu
Applications: BA
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Glutathione
Reductase Antibody
NBP2-16684
Western Blot Glutathione Reductase Antibody
Western Blot Glutathione Reductase Antibody
Western Blot Glutathione Reductase Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Glutathione
Peroxidase 1/GPX1 Ant ...
AF3798
Western Blot Glutathione Peroxidase 1/GPX1 Antibody [Unconjugated]
Simple Western Glutathione Peroxidase 1/GPX1 Antibody [Unconjugated]
Immunohistochemistry Glutathione Peroxidase 1/GPX1 Antibody [Unconjugated]
(29 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(637 Publications)
Species: Mu
Applications: ELISA
Bcl-2 Antibody
NB100-56098
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
(2 Reviews)
(26 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(61 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
ROS Antibody
(OTI1F3)
NBP2-45626
Immunohistochemistry ROS Antibody (OTI1F3)
Immunohistochemistry ROS Antibody (OTI1F3)
Immunohistochemistry ROS Antibody (OTI1F3)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(384 Publications)
Species: Hu, Mu
Applications: ICC, IHC
eNOS Antibody -
BSA Free
NB300-500
Western Blot eNOS Antibody - BSA Free
Immunohistochemistry-Paraffin eNOS Antibody - BSA Free
Immunohistochemistry-Paraffin eNOS Antibody - BSA Free
(3 Reviews)
(28 Publications)
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
SOD2/Mn-SOD
Recombinant Protein A
NBP1-86169PEP
SOD2/Mn-SOD Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SOD2/Mn-SOD Protein (NBP1-86169PEP) (0)

There are no publications for SOD2/Mn-SOD Protein (NBP1-86169PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOD2/Mn-SOD Protein (NBP1-86169PEP) (0)

There are no reviews for SOD2/Mn-SOD Protein (NBP1-86169PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SOD2/Mn-SOD Protein (NBP1-86169PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SOD2/Mn-SOD Products

Research Areas for SOD2/Mn-SOD Protein (NBP1-86169PEP)

Find related products by research area.

Blogs on SOD2/Mn-SOD

There are no specific blogs for SOD2/Mn-SOD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase-3 Antibody [Unconjugated] - Active
AF835

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SOD2/Mn-SOD Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SOD2