Home » Septin-9 » Septin-9 Proteins » Septin-9 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Septin-9 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Septin-9 Protein (NBP2-13294PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Septin-9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding Septin - 9.

Source: E. coli

Amino Acid Sequence: LGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTPEPAPRRTEITIVKPQESA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SEPT9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13294.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Septin-9 Recombinant Protein Antigen

  • AF17q25
  • FLJ75490
  • KIAA0991Ov/Br septin
  • MLL septin-like fusion protein MSF-A
  • MLL septin-like fusion protein
  • MSF1NAPB
  • MSFMLL septin-like fusion
  • Ovarian/Breast septin
  • PNUTL4
  • SeptD1
  • septin 9
  • Septin D1
  • septin-9
  • SINT1

Background

Septin 9 is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

USH1G Antibody
NBP1-89076
Immunohistochemistry-Paraffin USH1G Antibody
(1 Publication)
Species: Ca, Hu
Applications: IHC, IHC-P, WB
Septin-6 Antibody
NBP1-89626
Western Blot Septin-6 Antibody
Western Blot Septin-6 Antibody
Immunohistochemistry-Paraffin Septin-6 Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Pancreatic
Polypeptide/PP Antibo
NB100-1793
Flow Cytometry Pancreatic Polypeptide/PP Antibody
Immunohistochemistry-Paraffin Pancreatic Polypeptide/PP Antibody
Immunocytochemistry/ Immunofluorescence Pancreatic Polypeptide/PP Antibody
(3 Reviews)
(19 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Lubricin/PRG4
Antibody
NBP1-19048
Immunohistochemistry Lubricin/PRG4 Antibody
Immunohistochemistry Lubricin/PRG4 Antibody
(7 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Cholecystokinin
Antibody
NBP2-62664
Immunohistochemistry-Paraffin Cholecystokinin Antibody
Immunohistochemistry-Paraffin Cholecystokinin Antibody
Immunohistochemistry-Paraffin Cholecystokinin Antibody
Species: Hu
Applications: IHC, IHC-P
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Septin-2 Antibody
NBP1-85212
Immunohistochemistry-Paraffin Septin-2 Antibody
Immunocytochemistry/ Immunofluorescence Septin-2 Antibody
Immunohistochemistry-Paraffin Septin-2 Antibody
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Gastrin Antibody
NBP3-12223
Immunohistochemistry-Paraffin Gastrin Antibody
Unknown Gastrin Antibody
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

Acetylcholinesterase/A
NB100-1519
Flow Cytometry Acetylcholinesterase/ACHE Antibody
Western Blot Acetylcholinesterase/ACHE Antibody
Immunocytochemistry/ Immunofluorescence Acetylcholinesterase/ACHE Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
MIF Antibody
(12302) [Unconjugated
MAB289
Western Blot MIF Antibody (12302) [Unconjugated]
Simple Western MIF Antibody (12302) [Unconjugated]
(1 Review)
(28 Publications)
Species: Hu
Applications: Simple Western, WB
Septin-11 Antibody
NBP1-31717
Western Blot Septin-11 Antibody
Western Blot Septin-11 Antibody
Western Blot Septin-11 Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Inorganic
Pyrophosphatase/PPA1
NBP1-31348
Immunocytochemistry/ Immunofluorescence Inorganic Pyrophosphatase/PPA1 Antibody
Immunohistochemistry-Paraffin Inorganic Pyrophosphatase/PPA1 Antibody
Western Blot Inorganic Pyrophosphatase/PPA1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
S100A9 Antibody
[Unconjugated]
AF2065
Immunocytochemistry S100A9 Antibody [Unconjugated]
Immunohistochemistry S100A9 Antibody [Unconjugated]
Immunocytochemistry S100A9 Antibody [Unconjugated]
(2 Reviews)
(34 Publications)
Species: Mu
Applications: ICC, IHC, Simple Western, WB
S100A8 Antibody
[Unconjugated]
AF3059
Immunocytochemistry S100A8 Antibody [Unconjugated]
Western Blot S100A8 Antibody [Unconjugated]
Simple Western S100A8 Antibody [Unconjugated]
(2 Reviews)
(26 Publications)
Species: Mu
Applications: ICC, Simple Western, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(640 Publications)
Species: Mu
Applications: ELISA
RIPK2 Antibody
(6F7)
H00008767-M02
ELISA RIPK2 Antibody (6F7)
Immunohistochemistry-Paraffin RIPK2 Antibody (6F7)
Western Blot RIPK2 Antibody (6F7)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Septin-9
Recombinant Protein A
NBP2-13294PEP
Septin-9 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Septin-9 Protein (NBP2-13294PEP) (0)

There are no publications for Septin-9 Protein (NBP2-13294PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Septin-9 Protein (NBP2-13294PEP) (0)

There are no reviews for Septin-9 Protein (NBP2-13294PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Septin-9 Protein (NBP2-13294PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Septin-9 Products

Research Areas for Septin-9 Protein (NBP2-13294PEP)

Find related products by research area.

Blogs on Septin-9

There are no specific blogs for Septin-9, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: Fibronectin Antibody - BSA Free [NBP1-91258] - Nicotinamide (NAM) attenuates unilateral urethral obstruction (UUO)-induced renal interstitial fibrosis. C57BL/6 mice were subjected to UUO surgery or sham operation. Different doses of NAM or saline were intraperitoneally injected an hour before the surgery and daily thereafter. Representative images of Western blot of FN (fibronectin), alpha-SMA (alpha-smooth muscle actin) and GAPDH (loading control). Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30993884/) licensed under a CC-BY license.
Fibronectin Antibody - BSA Free
NBP1-91258

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Septin-9 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SEPT9