RHD Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of RHD. Peptide sequence: DYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAMLGA The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
RHD |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for RHD Antibody
Background
The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The classification of Rh positive and Rh negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. Alternative splicing of the gene results in four transcript variants encoding four different isoforms.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, IHC
Species: Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Publications for RHD Antibody (NBP2-84247) (0)
There are no publications for RHD Antibody (NBP2-84247).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RHD Antibody (NBP2-84247) (0)
There are no reviews for RHD Antibody (NBP2-84247).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RHD Antibody (NBP2-84247) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RHD Products
Research Areas for RHD Antibody (NBP2-84247)
Find related products by research area.
|
Blogs on RHD