| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERCC5. Source: E. coli Amino Acid Sequence: DDFSQYQLKGLLKKNYLNQHIEHVQKEMNQQHSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTVAEVDSESLPSSSKMHGMSFDVKSSPCE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | ERCC5 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47577. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here. |
| Theoretical MW | 29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for XPG Protein (NBP2-47577PEP)Find related products by research area.
|
|
PCNA (Proliferating cell nuclear antigen, polymerase delta auxiliary protein) PCNA is a nuclear protein essential for DNA replication as well as DNA excision and mismatch repair pathways. It coordinates the recruitment and association of needed components during both of these processes, both of which are essential for cell cycl... Read full blog post. |
|
PCNA Antibodies: Marking Cell Proliferation & DNA Replication Proliferating Cell Nuclear Antigen (PCNA), also known as the polymerase delta auxiliary protein, is a nuclear protein essential for DNA replication as well as DNA excision and mismatch repair pathways. It has a large role in cell cycle regulation and ... Read full blog post. |
|
Using PCNA as an Antibody Marker PCNA antibodies are useful biomarkers in DNA repair studies. PCNA is one of several proteins essential for the completion of nucleotide excision repair, a multi-stage process involving 20 - 30 proteins, and an important factor in repairing damage and ... Read full blog post. |
|
NER Antibodies in Cancer Research We at Novus Biologicals have over 230 products in our antibody catalog devoted to nucleotide excision repair. NER is a multi-stage sequential process involving over 30 proteins, all of which have been widely studied. Being the primary method to repair... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ERCC5 |
