![Western Blot: TMTC1 Antibody [NBP1-88837] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/TMTC1-Antibody-Western-Blot-NBP1-88837-img0005.jpg "Western Blot: TMTC1 Antibody [NBP1-88837] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GITVFGVCLVYDLFSLSNKQDKSSNGALCPRSPQQPGSPQPSSLPGHPHRENGKQQRFPHKGAWGGCHSPLPPEPKSSGFPVSPRAVWSMMR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TMTC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 [Unconjugated]")
![Western Blot OLFM-L3 Antibody (740404) [Unconjugated]](https://images.novusbio.com/images2/OLFM-L3_MAB7324_Western_Blot_11882.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TMTC1 |
![Immunocytochemistry/Immunofluorescence: TMTC1 Antibody [NBP1-88837] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and cytoplasm.](http://images.novusbio.com/fullsize/TMTC1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88837-img0004.jpg "Immunocytochemistry/Immunofluorescence: TMTC1 Antibody [NBP1-88837] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and cytoplasm.")
![Immunohistochemistry-Paraffin: TMTC1 Antibody [NBP1-88837] - Staining of human skeletal muscle shows no granular cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/TMTC1-Antibody-Immunohistochemistry-Paraffin-NBP1-88837-img0010.jpg "Immunohistochemistry-Paraffin: TMTC1 Antibody [NBP1-88837] - Staining of human skeletal muscle shows no granular cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: TMTC1 Antibody [NBP1-88837] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.](http://images.novusbio.com/fullsize/TMTC1-Antibody-Immunohistochemistry-Paraffin-NBP1-88837-img0006.jpg "Immunohistochemistry-Paraffin: TMTC1 Antibody [NBP1-88837] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.")
![Immunohistochemistry-Paraffin: TMTC1 Antibody [NBP1-88837] - Staining of human endometrium shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TMTC1-Antibody-Immunohistochemistry-Paraffin-NBP1-88837-img0007.jpg "Immunohistochemistry-Paraffin: TMTC1 Antibody [NBP1-88837] - Staining of human endometrium shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TMTC1 Antibody [NBP1-88837] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules and in glomeruli.](http://images.novusbio.com/fullsize/TMTC1-Antibody-Immunohistochemistry-Paraffin-NBP1-88837-img0008.jpg "Immunohistochemistry-Paraffin: TMTC1 Antibody [NBP1-88837] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules and in glomeruli.")
![Immunohistochemistry-Paraffin: TMTC1 Antibody [NBP1-88837] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TMTC1-Antibody-Immunohistochemistry-Paraffin-NBP1-88837-img0009.jpg "Immunohistochemistry-Paraffin: TMTC1 Antibody [NBP1-88837] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.")
![Western Blot EBF-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EBF-1_AF5165_Western_Blot_5645.jpg)
![Western Blot EBF-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af5165_human-mouse-ebf-1-affinity-purified-polyclonal-ab-41202412403559.jpg)
![Western Blot EBF-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af5165_human-mouse-ebf-1-affinity-purified-polyclonal-ab-41202412403592.jpg)
![Western Blot EBF-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EBF-2_AF7006_Western_Blot_11279.jpg)
![Immunohistochemistry EBF-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EBF-2_AF7006_Immunohistochemistry_11307.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Bioactivity BMP-2 [Unconjugated]](https://images.novusbio.com/images/protein/355-bm_recombinant-human-mouse-rat-bmp-2-protein-bioactivity-181120209742.jpg)
![Western Blot Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Western_Blot_5347.jpg)
![Chromatin Immunoprecipitation (ChIP) Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Chromatin_Immunoprecipitation_11240.jpg)
![Immunocytochemistry Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Immunocytochemistry_11829.jpg)
![Immunohistochemistry Glycophorin A Antibody (R10) [Unconjugated]](https://images.novusbio.com/images2/Glycophorin_A_MAB1228_Immunohistochemistry_19187.jpg)
![Flow Cytometry Glycophorin A Antibody (R10) [Unconjugated]](https://images.novusbio.com/images2/Glycophorin_A_MAB1228_Flow_Cytometry_19288.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")