Home » Tenascin R » Tenascin R Proteins » Tenascin R Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Tenascin R Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Tenascin R Protein (NBP1-86399PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Tenascin R Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TNR.

Source: E. coli

Amino Acid Sequence: QGLQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEYIVNVVALK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TNR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86399.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tenascin R Recombinant Protein Antigen

  • Janusin
  • MGC149328
  • Restrictin
  • tenascin R (restrictin, janusin)
  • Tenascin R
  • tenascin-R
  • TNR
  • TN-R

Background

TNR - tenascin R (restrictin, janusin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Tenascin C
Antibody (4C8MS) - BS
NB110-68136
Flow Cytometry Tenascin C Antibody (4C8MS) - BSA Free
Immunocytochemistry/ Immunofluorescence Tenascin C Antibody (4C8MS) - BSA Free
Flow Cytometry Tenascin C Antibody (4C8MS) - BSA Free
(2 Reviews)
(26 Publications)
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Neurocan Antibody
AF5800
Western Blot Neurocan Antibody
Immunohistochemistry Neurocan Antibody
(20 Publications)
Species: Mu, Rt
Applications: IHC, WB
PTP
beta/zeta/PTPRZ Antib
MAB2688
Western Blot PTP beta/zeta/PTPRZ Antibody (279244)
(1 Review)
(3 Publications)
Species: Hu
Applications: WB
Brevican Antibody
[Unconjugated]
AF4009
Western Blot Brevican Antibody [Unconjugated]
Immunocytochemistry Brevican Antibody [Unconjugated]
Immunohistochemistry Brevican Antibody [Unconjugated]
(11 Publications)
Species: Hu, Rt
Applications: ICC, IHC, IP, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(830 Publications)
Species: Hu
Applications: BA
Contactin-1
Antibody [Unconjugate
AF904
Western Blot Contactin-1 Antibody [Unconjugated]
Immunohistochemistry Contactin-1 Antibody [Unconjugated]
Neutralization Contactin-1 Antibody [Unconjugated]
(21 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
MAG/Siglec-4a
538-MG
MAG/Siglec-4a
(19 Publications)
Species: Rt
Applications: BA
Versican Antibody
[Unconjugated] - Isof ...
AF3054
Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0
Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0
Immunocytochemistry/ Immunofluorescence Versican Antibody [Unconjugated] - Isoform V0
(8 Publications)
Species: Hu
Applications: ICC, IHC, WB
Coagulation Factor
III/Tissue Factor [HR ...
DCF300
N/A Coagulation Factor III/Tissue Factor [HRP]
N/A Coagulation Factor III/Tissue Factor [HRP]
(26 Publications)
Species: Hu
Applications: ELISA
Tenascin X
Antibody [Unconjugate
AF6999
Western Blot Tenascin X Antibody [Unconjugated]
Immunohistochemistry Tenascin X Antibody [Unconjugated]
Simple Western Tenascin X Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, Simple Western, WB
Troponin C
(cardiac) Antibody
NBP2-37958
Immunohistochemistry-Paraffin Troponin C (cardiac) Antibody
Immunohistochemistry-Paraffin Troponin C (cardiac) Antibody
Immunohistochemistry-Paraffin Troponin C (cardiac) Antibody
Species: Hu
Applications: IHC, IHC-P
Carbonic Anhydrase
I/CA1 Antibody
NBP1-88191
Western Blot Carbonic Anhydrase I/CA1 Antibody
Immunohistochemistry-Paraffin Carbonic Anhydrase I/CA1 Antibody
Immunohistochemistry-Paraffin Carbonic Anhydrase I/CA1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Aggrecan
Neoepitope Antibody -
NB100-74350
Western Blot Aggrecan Neoepitope Antibody - BSA Free
Western Blot Aggrecan Neoepitope Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Aggrecan Neoepitope Antibody - BSA Free
(32 Publications)
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
ZNF160 Antibody
NBP1-83939
Immunohistochemistry-Paraffin ZNF160 Antibody
Immunocytochemistry/ Immunofluorescence ZNF160 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Coagulation Factor
XI Antibody
AF2460
Coagulation Factor XI Antibody
Species: Hu
Applications: IP, Neut, WB
FAM49B Antibody
NBP1-88582
Western Blot FAM49B Antibody
Immunohistochemistry-Paraffin FAM49B Antibody
Immunocytochemistry/ Immunofluorescence FAM49B Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

N-Acetylgalactosamine- ...
NBP1-32899
Western Blot N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
Western Blot N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
Immunocytochemistry/ Immunofluorescence N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
(2 Reviews)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Tenascin R Protein (NBP1-86399PEP) (0)

There are no publications for Tenascin R Protein (NBP1-86399PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tenascin R Protein (NBP1-86399PEP) (0)

There are no reviews for Tenascin R Protein (NBP1-86399PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tenascin R Protein (NBP1-86399PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tenascin R Products

Blogs on Tenascin R

There are no specific blogs for Tenascin R, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Tenascin R was detected in immersion fixed paraffin-embedded sections of human brainstem (medulla) using 1.7 µg/mL Goat Anti-Human Tenascin R Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3865) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Tenascin R Antibody
AF3865
Western Blot: Fibronectin Antibody - BSA Free [NBP1-91258] - Nicotinamide (NAM) attenuates unilateral urethral obstruction (UUO)-induced renal interstitial fibrosis. C57BL/6 mice were subjected to UUO surgery or sham operation. Different doses of NAM or saline were intraperitoneally injected an hour before the surgery and daily thereafter. Representative images of Western blot of FN (fibronectin), alpha-SMA (alpha-smooth muscle actin) and GAPDH (loading control). Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30993884/) licensed under a CC-BY license.
Fibronectin Antibody - BSA Free
NBP1-91258

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tenascin R Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TNR