Novus Biologicals products are now on bio-techne.com

STING/TMEM173 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: STING/TMEM173 Antibody [NBP2-38389] - Staining in human fallopian tube and liver tissues using NBP2-38389 antibody. Corresponding TMEM173 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: STING/TMEM173 Antibody [NBP2-38389] - Staining of human fallopian tube, liver, lymph node and prostate using Anti-TMEM173 antibody NBP2-38389 (A) shows ...read more
Western Blot: STING/TMEM173 Antibody [NBP2-38389] - Analysis in human cell line EFO-21.
Immunohistochemistry-Paraffin: STING/TMEM173 Antibody [NBP2-38389] - Staining of human Fallopian tube shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: STING/TMEM173 Antibody [NBP2-38389] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: STING/TMEM173 Antibody [NBP2-38389] - Staining of human lymph node shows strong membranous positivity in follicular dendritic cells.
Immunohistochemistry-Paraffin: STING/TMEM173 Antibody [NBP2-38389] - Staining of human prostate shows moderate membranous positivity in basal layer glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

STING/TMEM173 Antibody Summary

Immunogen
This STING/TMEM173 Antibody was developed against a recombinant protein corresponding to amino acids: YSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCQTLEDILADAPESQNNCR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM173
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
STING/TMEM173 Recombinant Protein Antigen (NBP2-38389PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Porcine (87%), Rat (83%), Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STING/TMEM173 Antibody

  • endoplasmic reticulum IFN stimulator
  • Endoplasmic reticulum interferon stimulator
  • ERIS
  • FLJ38577
  • hMITA
  • hSTING
  • Mediator of IRF3 activation
  • MITA
  • mitochondrial mediator of IRF3 activation
  • MPYS
  • NET23
  • N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner
  • SAVI
  • Stimulator of interferon genes protein
  • stimulator of interferon protein
  • STING
  • STING-beta
  • TMEM173
  • transmembrane protein 173

Background

STING (stimulator of interferon genes) is encoded by the TMEM173 gene and is an adaptor molecule involved in the activation of innate immune responses to PAMPS (pathogen-associated molecular patterns) and DAMPS (damage-associated molecular patterns). STING specifically recognizes cytosolic DNA products derived from pathogens (e.g., cytomegalovirus, vaccinia virus, Listeria monocytogenes) or dead cells (1, 2). In the STING pathway, dsDNA derived from pathogens or damaged cells serves as a substrate for the enzyme cGAS (cyclic GMP-AMP synthase) which produces the second messenger cyclic GMP-AMP (cGAMP) from ATP and GTP (3, 4). Under steady-state conditions STING (theoretical molecular weight 42 kDa), a protein localizes to the ER membrane. Upon activation by dsDNA derived second messenger (cGAMP), STING translocates to the Golgi apparatus as a homodimer. Once STING has trafficked to the perinuclear region, it activates TANK binding kinase 1 (TBK1), interferon regulatory factor 3 (IRF3) and NF-kB leading to the production of cytokines (e.g., type I interferon) (2, 4). Mutations in the TMEM173 gene affecting STING expression are associated with the development of the auto-inflammatory disease SAVI (STING-associated vasculopathy with onset in infancy) (2). A novel SAVI dominant mutation in the TMEM173 human gene (V155M) leads to increased localization of STING to the Golgi and perinuclear region, indicative of an activated state (1). Hallmarks of SAVI, a rare inflammatory disease, include severe vasculitis in extremities and lung inflammation (7).

References

1. Patel, S., & Jin, L. (2019). TMEM173 variants and potential importance to human biology and disease. Genes and Immunity. https://doi.org/10.1038/s41435-018-0029-9

2. Jounai, N., Kobiyama, K., Takeshita, F., & Ishii, K. J. (2013). Recognition of damage-associated molecular patterns related to nucleic acids during inflammation and vaccination. Frontiers in Cellular and Infection Microbiology. https://doi.org/10.3389/fcimb.2012.00168

3. Xiao, T. S., & Fitzgerald, K. A. (2013). The cGAS-STING Pathway for DNA Sensing. Molecular Cell. https://doi.org/10.1016/j.molcel.2013.07.004

4. Kato, K., Omura, H., Ishitani, R., & Nureki, O. (2017). Cyclic GMP-AMP as an Endogenous Second Messenger in Innate Immune Signaling by Cytosolic DNA. Annual Review of Biochemistry. https://doi.org/10.1146/annurev-biochem-061516-044813

5. Crowl, J. T., Gray, E. E., Pestal, K., Volkman, H. E., & Stetson, D. B. (2017). Intracellular Nucleic Acid Detection in Autoimmunity. Annual Review of Immunology. https://doi.org/10.1146/annurev-immunol-051116-052331

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56705
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
NBP2-67741
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-80859
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF4859
Species: Hu
Applications: WB
8499-IF
Species: Hu
Applications: BA
NBP1-84809
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-24729
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-27354
Species: Hu
Applications: WB
NB120-13810
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP1-76854
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-84265
Species: Hu
Applications: IHC, IHC-P

Publications for STING/TMEM173 Antibody (NBP2-38389) (0)

There are no publications for STING/TMEM173 Antibody (NBP2-38389).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STING/TMEM173 Antibody (NBP2-38389) (0)

There are no reviews for STING/TMEM173 Antibody (NBP2-38389). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STING/TMEM173 Antibody (NBP2-38389) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STING/TMEM173 Products

Research Areas for STING/TMEM173 Antibody (NBP2-38389)

Find related products by research area.

Blogs on STING/TMEM173.

STING in Innate Immunity and Cancer: What’s the Buzz About?
STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also ...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STING/TMEM173 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM173
Uniprot