Home » SLC38A2 » SLC38A2 Proteins » SLC38A2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SLC38A2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SLC38A2 Recombinant Protein Antigen (NBP1-88872PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SLC38A2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC38A2.

Source: E. coli

Amino Acid Sequence: MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEFHP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC38A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88872.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC38A2 Recombinant Protein Antigen

  • Amino acid transporter A2
  • ata2
  • ATA2System A transporter 1
  • KIAA1382System N amino acid transporter 2
  • pro1068
  • Protein 40-9-1
  • sat2
  • SAT2PRO1068
  • snat2
  • SNAT2amino acid transporter 2
  • sodium-coupled neutral amino acid transporter 2
  • Solute carrier family 38 member 2
  • solute carrier family 38, member 2
  • System A amino acid transporter 2

Background

SLC38A2 functions as a sodium-dependent amino acid transporter. Mediates the saturable, pH-sensitive and electrogenic cotransport of neutral amino acids and sodium ions with a stoichiometry of 1:1. May function in the transport of amino acids at the blood-brain b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SLC38A1 Antibody
(S104-32)
NBP2-59311
Western Blot SLC38A1 Antibody (S104-32)
Immunocytochemistry/ Immunofluorescence SLC38A1 Antibody (S104-32)
Western Blot SLC38A1 Antibody (S104-32)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
SAT1 Antibody -
BSA Free
NB110-41622
Western Blot SAT1 Antibody - BSA Free
Immunohistochemistry SAT1 Antibody - BSA Free
(5 Publications)
Species: Bv, Ch, Gt, Hu, Mu, Po, Rt, Xp
Applications: IHC, IHC-P, WB
SLC38A4 Antibody
NBP1-55228
Immunohistochemistry-Paraffin SLC38A4 Antibody
Western Blot SLC38A4 Antibody
Western Blot SLC38A4 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
SLC7A5/LAT1
Antibody (BU53) - BSA
NBP2-50465
Immunohistochemistry-Paraffin SLC7A5/LAT1 Antibody (BU53) - BSA Free
Flow (Cell Surface) SLC7A5/LAT1 Antibody (BU53) - BSA Free
Flow (Cell Surface) SLC7A5/LAT1 Antibody (BU53) - BSA Free
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
SLC26A1 Antibody
NBP1-84897
Immunohistochemistry-Paraffin SLC26A1 Antibody
Immunocytochemistry/ Immunofluorescence SLC26A1 Antibody
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
SLC38A3 Antibody
NBP1-60103
Immunohistochemistry SLC38A3 Antibody
Immunohistochemistry SLC38A3 Antibody
Western Blot SLC38A3 Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, WB
SLC1A5 Antibody
NBP1-89327
Immunohistochemistry-Paraffin SLC1A5 Antibody
Immunohistochemistry-Paraffin SLC1A5 Antibody
Immunohistochemistry-Paraffin SLC1A5 Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
SLC7A8 Antibody
(OTI7D6)
NBP1-47989
Western Blot SLC7A8 Antibody (OTI7D6)
Immunohistochemistry-Paraffin SLC7A8 Antibody (OTI7D6)
Immunohistochemistry-Paraffin SLC7A8 Antibody (OTI7D6)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
LAT Antibody
NBP2-27104
Western Blot LAT Antibody
Immunohistochemistry-Paraffin LAT Antibody
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(809 Publications)
Species: Hu
Applications: BA
Glut1 Antibody -
BSA Free
NB110-39113
Western Blot Glut1 Antibody - BSA Free
Flow Cytometry Glut1 Antibody - BSA Free
Western Blot Glut1 Antibody - BSA Free
(7 Reviews)
(62 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Serotonin
N-acetyltransferase [ ...
NB120-3439
Western Blot Serotonin N-acetyltransferase [p Thr29] Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NTAL Antibody
[Unconjugated]
AF4066
Western Blot NTAL Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry NTAL Antibody [Unconjugated]
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
SLC38A5 Antibody
NBP1-92402
Immunohistochemistry-Paraffin SLC38A5 Antibody
Immunohistochemistry-Paraffin SLC38A5 Antibody
Immunohistochemistry-Paraffin SLC38A5 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
IGF-II/IGF2
[Unconjugated]
292-G2
SDS-PAGE IGF-II/IGF2 [Unconjugated]
Bioactivity IGF-II/IGF2 [Unconjugated]
(47 Publications)
Species: Hu
Applications: BA
SLC6A12 Antibody
NBP1-88641
Immunocytochemistry/ Immunofluorescence SLC6A12 Antibody
Immunocytochemistry/ Immunofluorescence SLC6A12 Antibody
Western Blot SLC6A12 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for SLC38A2 Recombinant Protein Antigen (NBP1-88872PEP) (0)

There are no publications for SLC38A2 Recombinant Protein Antigen (NBP1-88872PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC38A2 Recombinant Protein Antigen (NBP1-88872PEP) (0)

There are no reviews for SLC38A2 Recombinant Protein Antigen (NBP1-88872PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC38A2 Recombinant Protein Antigen (NBP1-88872PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC38A2 Products

Array NBP1-88872PEP

Blogs on SLC38A2

There are no specific blogs for SLC38A2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: Glut1 Antibody [NB110-39113] - Glut1 in human brain lysate (55 kDa). Antibody at 1:500. Western blot image submitted by a verified customer review.
Glut1 Antibody - BSA Free
NB110-39113

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC38A2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC38A2