![Western Blot: SGK Antibody (4D7-G3) [H00006446-M01] - Analysis of SGK expression in transfected 293T cell line by SGK monoclonal antibody (M01), clone 4D7-G3.Lane 1: SGK transfected lysate(48.9 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/SGK-Antibody-4D7-G3-Western-Blot-H00006446-M01-img0016.jpg "Western Blot: SGK Antibody (4D7-G3) [H00006446-M01] - Analysis of SGK expression in transfected 293T cell line by SGK monoclonal antibody (M01), clone 4D7-G3.Lane 1: SGK transfected lysate(48.9 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, KD |
| Clone | 4D7-G3 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | SGK (AAH01263.1, 1 a.a. ~ 431 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL |
| Localization | Cytoplasmic and Nuclear (on phosphorylation). |
| Specificity | SGK - serum/glucocorticoid regulated kinase |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SGK1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against cell lysate, transfected lysate and recominant protein for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Western Blot p70 S6 Kinase/S6K Antibody [Unconjugated]](https://images.novusbio.com/images2/p70_S6_Kinase_AF8962_Western_Blot_5937.jpg)
![Simple Western p70 S6 Kinase/S6K Antibody [Unconjugated]](https://images.novusbio.com/images2/16345.jpg)
![Immunohistochemistry p70 S6 Kinase/S6K Antibody [Unconjugated]](https://images.novusbio.com/images2/p70_S6_Kinase_AF8962_Immunohistochemistry_7347.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SGK1 Antibody (H00006446-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: SGK Antibody (4D7-G3) [H00006446-M01] - Analysis of monoclonal antibody to SGK on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/SGK-Antibody-4D7-G3-Immunocytochemistry-Immunofluorescence-H00006446-M01-img0009.jpg "Immunocytochemistry/Immunofluorescence: SGK Antibody (4D7-G3) [H00006446-M01] - Analysis of monoclonal antibody to SGK on HeLa cell. Antibody concentration 10 ug/ml.")
![Immunohistochemistry-Paraffin: SGK Antibody (4D7-G3) [H00006446-M01] - Analysis of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human stomach tissue. Antibody concentration 5 ug/ml.](http://images.novusbio.com/fullsize/SGK-Antibody-4D7-G3-Immunohistochemistry-Paraffin-H00006446-M01-img0013.jpg "Immunohistochemistry-Paraffin: SGK Antibody (4D7-G3) [H00006446-M01] - Analysis of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human stomach tissue. Antibody concentration 5 ug/ml.")
![Western Blot: SGK Antibody (4D7-G3) [H00006446-M01] - Western Blot analysis of SGK expression in A-549 ( Cat # L025V1 ).](http://images.novusbio.com/fullsize/SGK-Antibody-4D7-G3-Western-Blot-H00006446-M01-img0001.jpg "Western Blot: SGK Antibody (4D7-G3) [H00006446-M01] - Western Blot analysis of SGK expression in A-549 ( Cat # L025V1 ).")
![Western Blot: SGK Antibody (4D7-G3) [H00006446-M01] - Analysis of SGK over-expressed 293 cell line, cotransfected with SGK Validated Chimera RNAi ( Cat # H00006446-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SGK monoclonal antibody (M01) clone 4D7-G3 (Cat # H00006446-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/SGK-Antibody-4D7-G3-Western-Blot-H00006446-M01-img0014.jpg "Western Blot: SGK Antibody (4D7-G3) [H00006446-M01] - Analysis of SGK over-expressed 293 cell line, cotransfected with SGK Validated Chimera RNAi ( Cat # H00006446-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SGK monoclonal antibody (M01) clone 4D7-G3 (Cat # H00006446-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Immunohistochemistry-Paraffin: SGK Antibody (4D7-G3) [H00006446-M01] - Analysis of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/SGK-Antibody-4D7-G3-Immunohistochemistry-Paraffin-H00006446-M01-img0011.jpg "Immunohistochemistry-Paraffin: SGK Antibody (4D7-G3) [H00006446-M01] - Analysis of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.")
![ELISA: SGK1 Antibody (4D7-G3) [H00006446-M01] - SGK Antibody (4D7-G3) [H00006446-M01] - Detection limit for recombinant GST tagged SGK is approximately 1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/SGK-Antibody-4D7-G3-Sandwich-ELISA-H00006446-M01-img0015.jpg "ELISA: SGK1 Antibody (4D7-G3) [H00006446-M01] - SGK Antibody (4D7-G3) [H00006446-M01] - Detection limit for recombinant GST tagged SGK is approximately 1ng/ml as a capture antibody.")
![Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Simple_Western_16639.jpg)
![Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Western_Blot_9430.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunocytochemistry PDK-1 Antibody (650308) [Unconjugated]](https://images.novusbio.com/images2/PDK1_MAB864_Immunocytochemistry__Immunofluorescence_19624.jpg)
![Western Blot PDK-1 Antibody (650308) [Unconjugated]](https://images.novusbio.com/images2/PDK-1_MAB864_Western_Blot_9940.jpg)
![Simple Western PDK-1 Antibody (650308) [Unconjugated]](https://images.novusbio.com/images/antibody/mab864_human-mouse-rat-pdk-1-mab-clone-650308-simple-western-26420248573.jpg)
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")