![Western Blot: RDH13 Antibody [NBP1-92324] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize/RDH13-Antibody-Western-Blot-NBP1-92324-img0004.jpg "Western Blot: RDH13 Antibody [NBP1-92324] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GSGVTVNALHPGVARTELGRHTGIHGSTFSSTTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDGL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RDH13 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
| Publication using NBP1-92324 | Applications | Species |
|---|---|---|
| Gormley M, Ona K, Kapidzic M et al. Preeclampsia: novel insights from global RNA profiling of trophoblast subpopulations. Am J Obstet Gynecol 2017-03-24 [PMID: 28347715] |
Secondary Antibodies |
Isotype Controls |
Research Areas for RDH13 Antibody (NBP1-92324)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RDH13 |
![Immunocytochemistry/Immunofluorescence: RDH13 Antibody [NBP1-92324] - Staining of human cell line A-431 shows localization to cytosol & mitochondria.](http://images.novusbio.com/fullsize/RDH13-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92324-img0005.jpg "Immunocytochemistry/Immunofluorescence: RDH13 Antibody [NBP1-92324] - Staining of human cell line A-431 shows localization to cytosol & mitochondria.")
![Immunohistochemistry-Paraffin: RDH13 Antibody [NBP1-92324] - Staining of human retina shows cytoplasmic positivity in photoreceptor inner segments and nerve fibers.](http://images.novusbio.com/fullsize/RDH13-Antibody-Immunohistochemistry-Paraffin-NBP1-92324-img0006.jpg "Immunohistochemistry-Paraffin: RDH13 Antibody [NBP1-92324] - Staining of human retina shows cytoplasmic positivity in photoreceptor inner segments and nerve fibers.")
![Immunohistochemistry-Paraffin: RDH13 Antibody [NBP1-92324] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/RDH13-Antibody-Immunohistochemistry-Paraffin-NBP1-92324-img0002.jpg "Immunohistochemistry-Paraffin: RDH13 Antibody [NBP1-92324] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.")
![Western Blot Plexin C1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_C1_AF5375_Western_Blot_5704.jpg)
![Immunohistochemistry Plexin C1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_C1_AF5375_Immunohistochemistry_11462.jpg)
![Flow Cytometry Plexin C1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_C1_AF5375_Flow_Cytometry_8271.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunocytochemistry_11323.jpg)
![Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunohistochemistry_7025.jpg)
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin1_MAB4364_Immunocytochemistry_13008.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")