![Western Blot: RALYL Antibody [H00138046-B03P] - Analysis of RALYL expression in transfected 293T cell line. Lane 1: RALYL transfected lysate (32.30 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/RALYL-Antibody-Western-Blot-H00138046-B03P-img0003.jpg "Western Blot: RALYL Antibody [H00138046-B03P] - Analysis of RALYL expression in transfected 293T cell line. Lane 1: RALYL transfected lysate (32.30 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | RALYL (AAH31090.1, 1 a.a. - 291 a.a.) full-length human protein. MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARAAVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLSVGGYVFDYDYYRDDFYNRLFDYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSDELQTIKKELTQIKTKIDSLLGRLEKIEKQQKAEAEAQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | RALYL |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is useful for Western Blot, Functional |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
| Publication using H00138046-B03P | Applications | Species |
|---|---|---|
| Tsofack SP, Garand C, Sereduk C et al. NONO and RALY proteins are required for YB-1 oxaliplatin induced resistance in colon adenocarcinoma cell lines. Mol Cancer 2011-11-25 [PMID: 22118625] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RALYL |
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: RALYL Antibody [H00138046-B03P] - Analysis of purified antibody to RALYL on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/RALYL-Antibody-Immunocytochemistry-Immunofluorescence-H00138046-B03P-img0002.jpg "Immunocytochemistry/Immunofluorescence: RALYL Antibody [H00138046-B03P] - Analysis of purified antibody to RALYL on HeLa cell. Antibody concentration 10 ug/ml")
![Immunohistochemistry TrkA Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkA_AF1056_Immunohistochemistry_6672.jpg)
![Western Blot TrkA Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkA_AF1056_Western_Blot_17300.jpg)
![Immunohistochemistry TrkA Antibody [Unconjugated]](https://images.novusbio.com/images/af1056_rat-trka-affinity-purified-polyclonal-ab-8220249503264.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")