Novus Biologicals products are now on bio-techne.com

Rad9 Recombinant Protein Antigen

Name: Rad9 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-87163PEP
Price: 279 USD

Images

There are currently no images for Rad9 Protein (NBP1-87163PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Rad9 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAD9A. Source: E. coli Amino Acid Sequence: AIFTIKDSLLDGHFVLATLSDTDSHSQDLGSPERHQPVPQLQAHSTPHPDDFANDDIDSYMIAMETTIGNEGSRVLPSISLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKKFRSLFFGSILAPV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	RAD9A
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87163. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Rad9 Recombinant Protein Antigen

cell cycle checkpoint control protein RAD9A
DNA repair exonuclease rad9 homolog A
EC 3.1.11.2
hRAD9
RAD9 (S. pombe) homolog
RAD9 homolog A (S. pombe)
RAD9

Background

Human Rad9 is a homologue of Schizosaccharomyces pombe Rad9 protein and plays a critical role in cell cycle checkpoint control.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Rad17 [p Ser645]
Antibody

NBP2-24457

Immunohistochemistry-Paraffin Rad17 [p Ser645] Antibody

Species: Hu, Mu, Pm

Applications: IHC, IHC-P, WB

Rad1 Antibody (1G2)

H00005810-M01J

Immunohistochemistry-Paraffin Rad1 Antibody (1G2)

Species: Hu

Applications: ELISA, IHC, IHC-P, KD, ELISA(Cap), S-ELISA, WB

Chk2 [p Thr68]
Antibody [Unconjugate

AF1626

Immunocytochemistry Chk2 [p Thr68] Antibody [Unconjugated]

(9 Publications)

Species: Hu

Applications: ICC, WB

HUS1 Antibody

NBP1-33589

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

RRAD Antibody

NBP2-27500

(1 Publication)

Species: Mu

Applications: KO, PEP-ELISA, WB

ATR Antibody (2B5)

NB100-308

(21 Publications)

Species: Hu, Mu

Applications: Func, ICC/IF, IP, In vitro, KO, WB

XPF Antibody
(OTI4E11)

NBP2-01020

Immunohistochemistry-Paraffin XPF Antibody (OTI4E11)

Species: Hu, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Chk1 Antibody

NB100-464

Immunohistochemistry-Paraffin Chk1 Antibody

(12 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, IP, WB

ATM Antibody (2C1)

NB100-309

(3 Reviews)

(131 Publications)

Species: Hu, Pm, Mu, Rt

Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB

PCNA Antibody
(PC10)

NB500-106

(5 Reviews)

(45 Publications)

Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze

Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

MMAB Antibody
(OTI2G5)

NBP2-03417

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P, WB

TEM8/ANTXR1
Antibody (200C1339(SB ...

NB100-56585

Western Blot TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free

(5 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

53BP1 Antibody -
BSA Free

NB100-304

Knockout Validated 53BP1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence 53BP1 Antibody - BSA Free

(14 Reviews)

(753 Publications)

Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt

Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, KD, KO, WB

RAD52 Antibody

NBP2-58116

Immunocytochemistry/ Immunofluorescence RAD52 Antibody

(1 Review)

(1 Publication)

Species: Hu

Applications: ICC/IF, KD, WB

Rad51 Antibody
(14B4)

NB100-148

(5 Reviews)

(65 Publications)

Species: Ch, Hu, Mu, Rt

Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB

TopBP1 Antibody

NB100-217

(1 Review)

(19 Publications)

Species: Hu, Mu

Applications: IP, WB

ETV6/Tel Antibody

NBP1-80695

Immunohistochemistry-Paraffin ETV6/Tel Antibody

(5 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

BRCA1 Antibody
(RAY) - BSA Free

NB100-598

Immunocytochemistry/ Immunofluorescence BRCA1 Antibody (RAY) - BSA Free

Flow Cytometry BRCA1 Antibody (RAY) - BSA Free

(6 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, ICC/IF, IP, WB

MMR/CD206/Mannose
Receptor Antibody [Un ...

AF2535

Western Blot MMR/CD206/Mannose Receptor Antibody [Unconjugated]

(2 Reviews)

(188 Publications)

Species: Mu

Applications: CyTOF-ready, Flow, IHC, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(42 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for Rad9 Protein (NBP1-87163PEP) (0)

There are no publications for Rad9 Protein (NBP1-87163PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rad9 Protein (NBP1-87163PEP) (0)

There are no reviews for Rad9 Protein (NBP1-87163PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Rad9 Protein (NBP1-87163PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rad9 Products

Research Areas for Rad9 Protein (NBP1-87163PEP)

Find related products by research area.

Blogs on Rad9

There are no specific blogs for Rad9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Total protein from HeLa, A431, Neuro2A, and PC12 was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL in 5% block buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence. The observed molecular weight for these samples are ~250 kDa and the theoretical molecular weight is 214 kDa.

53BP1 Antibody - BSA Free
NB100-304

MMR/CD206 was detected in perfusion fixed frozen sections of mouse testis using Goat Anti-Mouse MMR/CD206 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2535) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to spermatocytes in testis. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.

MMR/CD206/Mannose Receptor Antibody [Unconjugated]
AF2535

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Rad9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

RAD9A

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Rad9 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Rad9 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Rad9 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Rad9 Protein (NBP1-87163PEP) (0)

Reviews for Rad9 Protein (NBP1-87163PEP) (0)

FAQs for Rad9 Protein (NBP1-87163PEP) (0)

Additional Rad9 Products

Research Areas for Rad9 Protein (NBP1-87163PEP)

Blogs on Rad9

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics