Home » Plexin B1 » Plexin B1 Proteins » Plexin B1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Plexin B1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Plexin B1 Protein (NBP1-87782PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Plexin B1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLXNB1.

Source: E. coli

Amino Acid Sequence: PGDNECVMELEGLEVVVEARVECEPPPDTQCHVTCQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLYDCSVGHGDCSRCQTAMPQYGCVWC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLXNB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87782.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Plexin B1 Recombinant Protein Antigen

  • Plexin B1
  • PLXN5
  • PLXNB1
  • SEP
  • Transmembrane Protein SEP

Background

Receptor for SEMA4D. Plays a role in RHOA activation and subsequent changes of the actin cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IRF1 Antibody
AF4715
Western Blot IRF1 Antibody
(1 Review)
(2 Publications)
Species: Mu
Applications: WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot PMEL17/SILV Antibody (OTI10E5)
Immunohistochemistry-Paraffin PMEL17/SILV Antibody (OTI10E5)
Immunohistochemistry-Paraffin PMEL17/SILV Antibody (OTI10E5)
(1 Review)
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Cathepsin L
Antibody [Unconjugate
AF952
Western Blot Cathepsin L Antibody [Unconjugated]
Immunohistochemistry Cathepsin L Antibody [Unconjugated]
Western Blot Cathepsin L Antibody [Unconjugated]
(27 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Neurolysin
Antibody (OTI1D6) - A ...
NBP2-72961
Western Blot Neurolysin Antibody (OTI1D6) - Azide and BSA Free
Western Blot Neurolysin Antibody (OTI1D6) - Azide and BSA Free
Flow Cytometry Neurolysin Antibody (OTI1D6) - Azide and BSA Free
Species: Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, WB
Semaphorin
4D/CD100 Antibody [Un ...
AF5235
Flow Cytometry Semaphorin 4D/CD100 Antibody [Unconjugated]
Immunohistochemistry Semaphorin 4D/CD100 Antibody [Unconjugated]
(1 Publication)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
ENDOGL1 Antibody
(2F7)
H00009941-M02
Immunocytochemistry/ Immunofluorescence ENDOGL1 Antibody (2F7)
Immunohistochemistry-Paraffin ENDOGL1 Antibody (2F7)
Western Blot ENDOGL1 Antibody (2F7)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
SUB1 Antibody
NBP1-82454
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
SF3B14 Antibody
NBP1-87431
Immunocytochemistry/ Immunofluorescence SF3B14 Antibody
Immunohistochemistry-Paraffin SF3B14 Antibody
Immunohistochemistry-Paraffin SF3B14 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ROBLD3 Antibody
NBP1-71687
Immunocytochemistry/ Immunofluorescence ROBLD3 Antibody
Immunohistochemistry ROBLD3 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
S100A9 Antibody
[Unconjugated]
AF2065
Immunocytochemistry S100A9 Antibody [Unconjugated]
Immunohistochemistry S100A9 Antibody [Unconjugated]
Immunocytochemistry S100A9 Antibody [Unconjugated]
(2 Reviews)
(34 Publications)
Species: Mu
Applications: ICC, IHC, Simple Western, WB
RPP14 Antibody
NBP1-80965
Western Blot RPP14 Antibody
Immunocytochemistry/ Immunofluorescence RPP14 Antibody
Immunohistochemistry-Paraffin RPP14 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CDK2AP2 Antibody
H00010263-B01P
Western Blot CDK2AP2 Antibody
Western Blot CDK2AP2 Antibody
Western Blot CDK2AP2 Antibody
Species: Hu, Mu, Rt
Applications: WB
Exosome component
10 Antibody
NBP1-32870
Western Blot Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
Western Blot Exosome component 10 Antibody
(2 Reviews)
(3 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Cathepsin C/DPPI
Antibody [Unconjugate ...
AF1034
Western Blot Cathepsin C/DPPI Antibody [Unconjugated]
Immunohistochemistry Cathepsin C/DPPI Antibody [Unconjugated]
Western Blot Cathepsin C/DPPI Antibody [Unconjugated]
(13 Publications)
Species: Mu, Rt
Applications: IHC, Simple Western, WB
NOC2L Antibody
NBP1-92190
Immunocytochemistry/ Immunofluorescence NOC2L Antibody
Western Blot NOC2L Antibody
Immunohistochemistry-Paraffin NOC2L Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB

Publications for Plexin B1 Protein (NBP1-87782PEP) (0)

There are no publications for Plexin B1 Protein (NBP1-87782PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plexin B1 Protein (NBP1-87782PEP) (0)

There are no reviews for Plexin B1 Protein (NBP1-87782PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Plexin B1 Protein (NBP1-87782PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Plexin B1 Products

Blogs on Plexin B1

There are no specific blogs for Plexin B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
p19ARF/CDKN2A Antibody - BSA Free
NB200-106
S100A9 was detected in immersion fixed XB2 mouse teratoma keratinocyte cell line using 10 µg/mL Goat Anti-Mouse S100A9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2065) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; NL001) and counte-rstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
S100A9 Antibody [Unconjugated]
AF2065
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
NOD2 Antibody (2D9) - BSA Free
NB100-524

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Plexin B1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PLXNB1